Yersinia pestis Shasta: BZ15_2842 Help Entry BZ15_2842         CDS       T03718                                  Name (GenBank) rod binding family protein   KO K02395   peptidoglycan hydrolase FlgJ Organism ypv  Yersinia pestis Shasta Pathway ypv02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:ypv00001]  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     BZ15_2842  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:ypv02035]     BZ15_2842 Bacterial motility proteins [BR:ypv02035]  Flagellar system   Flagellar assembly proteins    Rod and hook     BZ15_2842 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Rod-binding Motif Other DBs NCBI-ProteinID:  AJJ51779 UniProt:  A0A3G5L8F0 LinkDB All DBs Position complement(3147459..3147752) Genome browser AA seq 97 aa AA seqDB search MIEAINKSSPVIPGSFVGDLQPQDLEQAAVQFEAVFMRTLLQQMRKAAEVLAADDDPFNS KQQRMMRDFYDDKLASTLASQRSSGIANLLIQQLGSK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgattgaagccattaataaatcatccccggtgataccggggagttttgtcggtgacctc cagccgcaagatttggaacaagccgcggtgcagtttgaagcggtatttatgcgcacgtta ttgcaacagatgcgcaaagccgccgaggtgctggccgccgatgatgacccgtttaacagt aaacaacagcgcatgatgcgtgacttttacgatgacaaactggcctccacgttggcatca cagcgcagcagtggcattgctaatttgttgatccagcagttgggcagtaaataa

DBGET integrated database retrieval system