Yersinia pestis PBM19: CH59_236 Help Entry CH59_236          CDS       T03716                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ypw  Yersinia pestis PBM19 Pathway ypw01100   Metabolic pathways ypw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ypw00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CH59_236 (acpP)    00074 Mycolic acid biosynthesis     CH59_236 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CH59_236 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 TerB DUF1896 TMEM210 Motif Other DBs NCBI-ProteinID:  AJI92940 UniProt:  A0AAX2HYR2 LinkDB All DBs Position complement(279897..280133) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIVEQLGVKEDEVKNSASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDFINANQQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaatcatcgttgaacaactgggtgttaaagaa gacgaagtgaagaacagtgcttctttcgttgaagatcttggcgcggattctctggacacc gtcgagctggtaatggctctggaagaagaatttgataccgagattccagacgaagaagca gagaaaatcactactgttcaggcagctattgattttatcaacgctaaccagcagtaa

DBGET integrated database retrieval system