Yersinia pestis PBM19: CH59_2461 Help Entry CH59_2461         CDS       T03716                                  Symbol ptsO Name (GenBank) phosphocarrier protein NPr   KO K08485   phosphocarrier protein NPr Organism ypw  Yersinia pestis PBM19 Pathway ypw02060   Phosphotransferase system (PTS) Brite KEGG Orthology (KO) [BR:ypw00001]  09130 Environmental Information Processing   09131 Membrane transport    02060 Phosphotransferase system (PTS)     CH59_2461 (ptsO)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:ypw02000]     CH59_2461 (ptsO) Transporters [BR:ypw02000]  Phosphotransferase system (PTS)   Enzyme I and HPr    Phosphocarrier protein HPr [TC:8.A.8]     CH59_2461 (ptsO) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PTS-HPr Motif Other DBs NCBI-ProteinID:  AJI89934 UniProt:  A0AAX2HWH7 LinkDB All DBs Position complement(2772636..2772908) Genome browser AA seq 90 aa AA seqDB search MTVKQTVEIKNKLGMHARPAMKLFELVQSFDAEVMLRNDSGTEAEASSVIALLMLDSAKG RQIEVEATGVDEIQALAAVIELFNSGFDED NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgactgtcaaacaaaccgttgagatcaaaaacaagctgggaatgcacgccagacccgcg atgaaattgttcgagctggttcagagttttgatgcagaagtgatgttacgcaatgacagc ggtaccgaagcggaggccagcagcgtcattgcgctgctgatgctggattcagccaaaggc cgccaaatagaggttgaagcaaccggggttgatgaaattcaggcattggcagcggttatc gagttgtttaattcgggatttgacgaagattaa

DBGET integrated database retrieval system