Yersinia pestis PBM19: CH59_3624 Help Entry CH59_3624         CDS       T03716                                  Symbol ccmD Name (GenBank) heme exporter protein CcmD   KO K02196   heme exporter protein D Organism ypw  Yersinia pestis PBM19 Pathway ypw02010   ABC transporters Brite KEGG Orthology (KO) [BR:ypw00001]  09130 Environmental Information Processing   09131 Membrane transport    02010 ABC transporters     CH59_3624 (ccmD)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:ypw02000]     CH59_3624 (ccmD) Transporters [BR:ypw02000]  ABC transporters, prokaryotic type   ABC-2 type and other transporters    Heme transporter     CH59_3624 (ccmD) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CcmD GMIP-like_FCH PAP_PilO FAM165 Motif Other DBs NCBI-ProteinID:  AJI92533 UniProt:  A0AAX2I3N1 LinkDB All DBs Position 3980070..3980372 Genome browser AA seq 100 aa AA seqDB search MTPAFHSWAEFFAMGNYAFYVWLAVAATLLSLLGLLMHTLWQHKQLLADIHRRQAREQRI RQAQLNQTSMHQVPLHQAPLHQAPLQQAPQHIANLQEKRP NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgacccccgcttttcactcatgggcagaattttttgccatgggcaactatgccttttat gtctggctcgctgtggcagccaccttgttatcattgctgggcttgctaatgcacacgctg tggcagcacaaacagctactggccgatattcaccgccgtcaggctcgggaacaacgtatt cgtcaggcgcagcttaaccagacatcgatgcatcaagtaccgttgcatcaagcaccatta catcaagcaccgttacaacaagcaccccagcacatcgccaatttacaggagaagcgaccg tga

DBGET integrated database retrieval system