Yersinia pseudotuberculosis YPIII (serotype O 3): YPK_2693
Help
Entry
YPK_2693 CDS
T00665
Name
(GenBank) ATP-dependent Clp protease adaptor protein ClpS
KO
K06891
ATP-dependent Clp protease adaptor protein ClpS
Organism
ypy
Yersinia pseudotuberculosis YPIII (serotype O:3)
Brite
KEGG Orthology (KO) [BR:
ypy00001
]
09190 Not Included in Pathway or Brite
09192 Unclassified: genetic information processing
99975 Protein processing
YPK_2693
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ClpS
Motif
Other DBs
NCBI-ProteinID:
ACA68970
UniProt:
B1JRG2
LinkDB
All DBs
Position
complement(2974373..2974693)
Genome browser
AA seq
106 aa
AA seq
DB search
MGKNNDWLNFEHLVKDKQIEALQPPSMYKVILNNDDYTPMEFVIDVLQKFFSYDIERATQ
LMLNVHYQGKAICGVFTAEVAETKVAHVNQYARENEHPLLCTLEKA
NT seq
321 nt
NT seq
+upstream
nt +downstream
nt
atgggcaagaacaacgactggctgaattttgaacatttagtcaaagataaacaaatcgag
gcgcttcaaccgccttcgatgtataaagtgatacttaacaacgacgattacacaccgatg
gaatttgtgattgacgttctgcaaaagttcttttcttatgatattgaacgtgcaacacag
ctgatgctcaatgtgcattatcaaggaaaggcgatttgtggtgtttttactgctgaagtg
gcagagacaaaagtcgcccatgtaaatcaatacgccagggagaacgagcatccactgctt
tgtacgctggaaaaagcctga
DBGET
integrated database retrieval system