Yersinia pestis Z176003: YPZ3_2952 Help Entry YPZ3_2952         CDS       T01210                                  Symbol rpiB Name (GenBank) ribose-5-phosphate isomerase B   KO K01808   ribose 5-phosphate isomerase B [EC:5.3.1.6] Organism ypz  Yersinia pestis Z176003 Pathway ypz00030   Pentose phosphate pathway ypz00051   Fructose and mannose metabolism ypz00710   Carbon fixation by Calvin cycle ypz01100   Metabolic pathways ypz01110   Biosynthesis of secondary metabolites ypz01120   Microbial metabolism in diverse environments ypz01200   Carbon metabolism ypz01230   Biosynthesis of amino acids Module ypz_M00004   Pentose phosphate pathway (Pentose phosphate cycle) ypz_M00007   Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P Brite KEGG Orthology (KO) [BR:ypz00001]  09100 Metabolism   09101 Carbohydrate metabolism    00030 Pentose phosphate pathway     YPZ3_2952 (rpiB)    00051 Fructose and mannose metabolism     YPZ3_2952 (rpiB)   09102 Energy metabolism    00710 Carbon fixation by Calvin cycle     YPZ3_2952 (rpiB) Enzymes [BR:ypz01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.1  Interconverting aldoses and ketoses, and related compounds     5.3.1.6  ribose-5-phosphate isomerase      YPZ3_2952 (rpiB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LacAB_rpiB Motif Other DBs NCBI-ProteinID:  ADE65861 LinkDB All DBs Position 3790677..3791132 Genome browser AA seq 151 aa AA seqDB search MLSIAIGCDDAAIEMKNQIVIFLQSKNITVVDYSCDQHQEPTMYPDIAIQVALAIKAGKH ERGILICGTGIGMSISANKVFGVRAAQCHDTFSAQRARKSNNAQIICLGARVIGPELAKT LIEAWLDAEFDGGGSTEKVERIRYYEQSLHD NT seq 456 nt NT seq  +upstreamnt  +downstreamnt atgttatctattgcaatcggctgtgatgatgccgctattgagatgaaaaaccagattgtt atttttctacaaagtaagaacatcactgtcgtcgattacagctgcgatcaacaccaagaa ccgacgatgtaccccgatattgccattcaggttgctctggcgattaaagccgggaaacat gaacgcgggatccttatttgtggaacaggtattgggatgagcatctctgccaataaagtt tttggcgtccgtgcagctcagtgccatgatactttttctgcccaacgagccagaaaaagc aacaatgcccaaattatctgtttaggcgctcgcgttattggcccggagttagccaaaacc ctgatcgaggcttggttagatgctgaatttgacggagggggatcaacggaaaaagtggaa cggatccgctattacgaacagagcctgcatgattga

DBGET integrated database retrieval system