Yokenella regensburgei: HEC60_22625 Help Entry HEC60_22625       CDS       T06519                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism yre  Yokenella regensburgei Pathway yre01100   Metabolic pathways yre01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:yre00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HEC60_22625    00074 Mycolic acid biosynthesis     HEC60_22625   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HEC60_22625 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QIU92402 LinkDB All DBs Position complement(4704930..4705187) Genome browser AA seq 85 aa AA seqDB search MQALYLEIKNLIIETLNLDELTADDIDADAALFGDGLGLDSIDALELGLAVKNQYGIVLS AESEEMRQHFYSVATLAAFIHSQRA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcaagcgctttatcttgaaattaaaaatcttattattgaaaccttaaatctggacgaa ctgaccgcggacgacatcgatgccgatgctgcgctgttcggggatggattaggtctggac tctatcgacgcattagagcttggtctggcggtgaaaaatcagtacggcatcgtcctgtcc gcagagagtgaagagatgcgtcagcacttctactccgtggcaaccctggccgcttttatt cactcacaacgcgcctga

DBGET integrated database retrieval system