Yoonia rhodophyticola: AABB31_17125 Help Entry AABB31_17125      CDS       T10513                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism yrh  Yoonia rhodophyticola Pathway yrh01100   Metabolic pathways yrh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:yrh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AABB31_17125    00074 Mycolic acid biosynthesis     AABB31_17125   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AABB31_17125 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  WZU66719 UniProt:  A0AAN0NLC4 LinkDB All DBs Position 134520..134780 Genome browser AA seq 86 aa AA seqDB search MDTKDQVVAIIADQAMVERTDVKMDHTLDDLGIDSMGLVECIFAIEEAFDITVPFNANAP TESEFDISSVAAIVKAVESLMAQQGA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atggataccaaggatcaggtcgtggcgattattgccgatcaggcaatggtggaacgcacc gatgtgaagatggatcacacgctggatgatcttgggatcgacagcatggggctggtggaa tgcatctttgccatagaagaggcgtttgacatcaccgttcccttcaatgccaacgccccg accgagagcgaatttgacatctcgtccgtcgcggcaatcgtcaaggcggttgaaagcttg atggcgcaacagggggcctga

DBGET integrated database retrieval system