Yersinia rohdei: CH64_1970 Help Entry CH64_1970         CDS       T03610                                  Name (GenBank) rod binding family protein   KO K02395   peptidoglycan hydrolase FlgJ Organism yro  Yersinia rohdei Pathway yro02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:yro00001]  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     CH64_1970  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:yro02035]     CH64_1970 Bacterial motility proteins [BR:yro02035]  Flagellar system   Flagellar assembly proteins    Rod and hook     CH64_1970 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Rod-binding TetR_C_7 Motif Other DBs NCBI-ProteinID:  AJJ11126 UniProt:  A0A0U1HNZ3 LinkDB All DBs Position complement(2189116..2189409) Genome browser AA seq 97 aa AA seqDB search MIEAINKSAPVMPGSISGDLRPENLEQAAVQFEALFMRTLLTQMRKAAEALAADDDPFNS KQQRMMRDFYDDKLASTLASQRSSGIAHLLIQQLGSK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgattgaagcaattaataaatcagccccggtgatgccggggagtatttccggcgattta cggcccgaaaacttagaacaggcggcggtgcaatttgaggcgctgtttatgcgcacctta ctgacacagatgcgcaaagccgcagaggccctggccgccgatgatgacccctttaacagt aagcagcagcgcatgatgcgggatttttacgatgacaaactggcttctactttggcctcg cagcgcagcagcggcattgcgcatttgctgattcaacagttgggttctaaatag

DBGET integrated database retrieval system