Yersinia rohdei: CH64_931 Help Entry CH64_931          CDS       T03610                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism yro  Yersinia rohdei Pathway yro01100   Metabolic pathways yro01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:yro00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CH64_931 (acpP)    00074 Mycolic acid biosynthesis     CH64_931 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CH64_931 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 TerB DUF1896 TMEM210 Motif Other DBs NCBI-ProteinID:  AJJ10887 UniProt:  A0A0U1HMN4 LinkDB All DBs Position complement(1014063..1014299) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIVEQLGVKEDEVKNSASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDFINANQQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaatcatcgttgaacaactgggtgttaaagaa gacgaagtgaagaacagcgcttctttcgttgaagatcttggcgcggattctctggacacc gttgagctggtaatggctctggaagaagagtttgataccgagattccagacgaagaagca gaaaaaatcactactgttcaggcagctattgattttatcaacgctaaccaacagtaa

DBGET integrated database retrieval system