Yersinia rohdei: CH64_98 Help Entry CH64_98           CDS       T03610                                  Symbol cbiN Name (GenBank) cobalt transport family protein   KO K02009   cobalt/nickel transport protein Organism yro  Yersinia rohdei Pathway yro02010   ABC transporters Brite KEGG Orthology (KO) [BR:yro00001]  09130 Environmental Information Processing   09131 Membrane transport    02010 ABC transporters     CH64_98 (cbiN)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:yro02000]     CH64_98 (cbiN) Transporters [BR:yro02000]  ABC transporters, prokaryotic type   Metallic cation, iron-siderophore and vitamin B12 transporters    Cobalt transporter     CH64_98 (cbiN)    Nickel transporter     CH64_98 (cbiN) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CbiN Motif Other DBs NCBI-ProteinID:  AJJ10727 UniProt:  A0A0U1HSE6 LinkDB All DBs Position 111725..112006 Genome browser AA seq 93 aa AA seqDB search MKKTLILLAMVIALVILPFFINHGGEYGGSDGEAEALIQVTAPHYQPWFQPLYEPASGEI ESLLFTLQGSIGAAVIFYILGYYRGKHGEHAGD NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgaaaaagacccttattttgctggcgatggtgatcgccttggttatattgcccttcttt atcaatcatggcggtgaatatggcggctcagacggggaggccgaagccctgattcaggta acagcccctcattatcagccttggttccaacccttgtatgaacccgccagcggagaaatt gaaagtttattattcacgctgcaaggcagtattggtgcggcggtgattttctatatcttg ggctattaccgggggaaacacggtgagcatgctggggattga

DBGET integrated database retrieval system