Yersinia similis: BF17_21740 Help Entry BF17_21740        CDS       T03057                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ysi  Yersinia similis Pathway ysi01100   Metabolic pathways ysi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ysi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BF17_21740    00074 Mycolic acid biosynthesis     BF17_21740   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BF17_21740 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 TerB DUF1896 TMEM210 Motif Other DBs NCBI-ProteinID:  AHK21594 UniProt:  A0A0T9R058 LinkDB All DBs Position complement(4525411..4525647) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIVEQLGVKEDEVKNSASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDFINANQQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaatcatcgttgaacaactgggtgttaaagaa gacgaagtgaagaacagtgcttctttcgttgaagatcttggcgcggattctctggacacc gtcgagctggtaatggctctggaagaagaatttgataccgagattccagacgaagaagca gagaaaatcactactgttcaggcagctattgattttatcaacgctaaccagcagtaa

DBGET integrated database retrieval system