KEGG   Zalophus californianus (California sea lion): 113933258
Entry
113933258         CDS       T07874                                 
Symbol
MAPK3
Name
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
zca  Zalophus californianus (California sea lion)
Pathway
zca01521  EGFR tyrosine kinase inhibitor resistance
zca01522  Endocrine resistance
zca01524  Platinum drug resistance
zca04010  MAPK signaling pathway
zca04012  ErbB signaling pathway
zca04014  Ras signaling pathway
zca04015  Rap1 signaling pathway
zca04022  cGMP-PKG signaling pathway
zca04024  cAMP signaling pathway
zca04062  Chemokine signaling pathway
zca04066  HIF-1 signaling pathway
zca04068  FoxO signaling pathway
zca04071  Sphingolipid signaling pathway
zca04072  Phospholipase D signaling pathway
zca04114  Oocyte meiosis
zca04140  Autophagy - animal
zca04148  Efferocytosis
zca04150  mTOR signaling pathway
zca04151  PI3K-Akt signaling pathway
zca04210  Apoptosis
zca04218  Cellular senescence
zca04261  Adrenergic signaling in cardiomyocytes
zca04270  Vascular smooth muscle contraction
zca04350  TGF-beta signaling pathway
zca04360  Axon guidance
zca04370  VEGF signaling pathway
zca04371  Apelin signaling pathway
zca04380  Osteoclast differentiation
zca04510  Focal adhesion
zca04520  Adherens junction
zca04540  Gap junction
zca04550  Signaling pathways regulating pluripotency of stem cells
zca04611  Platelet activation
zca04613  Neutrophil extracellular trap formation
zca04620  Toll-like receptor signaling pathway
zca04621  NOD-like receptor signaling pathway
zca04625  C-type lectin receptor signaling pathway
zca04650  Natural killer cell mediated cytotoxicity
zca04657  IL-17 signaling pathway
zca04658  Th1 and Th2 cell differentiation
zca04659  Th17 cell differentiation
zca04660  T cell receptor signaling pathway
zca04662  B cell receptor signaling pathway
zca04664  Fc epsilon RI signaling pathway
zca04666  Fc gamma R-mediated phagocytosis
zca04668  TNF signaling pathway
zca04713  Circadian entrainment
zca04720  Long-term potentiation
zca04722  Neurotrophin signaling pathway
zca04723  Retrograde endocannabinoid signaling
zca04724  Glutamatergic synapse
zca04725  Cholinergic synapse
zca04726  Serotonergic synapse
zca04730  Long-term depression
zca04810  Regulation of actin cytoskeleton
zca04910  Insulin signaling pathway
zca04912  GnRH signaling pathway
zca04914  Progesterone-mediated oocyte maturation
zca04915  Estrogen signaling pathway
zca04916  Melanogenesis
zca04917  Prolactin signaling pathway
zca04919  Thyroid hormone signaling pathway
zca04921  Oxytocin signaling pathway
zca04926  Relaxin signaling pathway
zca04928  Parathyroid hormone synthesis, secretion and action
zca04929  GnRH secretion
zca04930  Type II diabetes mellitus
zca04933  AGE-RAGE signaling pathway in diabetic complications
zca04934  Cushing syndrome
zca04935  Growth hormone synthesis, secretion and action
zca04960  Aldosterone-regulated sodium reabsorption
zca05010  Alzheimer disease
zca05020  Prion disease
zca05022  Pathways of neurodegeneration - multiple diseases
zca05034  Alcoholism
zca05132  Salmonella infection
zca05133  Pertussis
zca05135  Yersinia infection
zca05140  Leishmaniasis
zca05142  Chagas disease
zca05145  Toxoplasmosis
zca05152  Tuberculosis
zca05160  Hepatitis C
zca05161  Hepatitis B
zca05163  Human cytomegalovirus infection
zca05164  Influenza A
zca05165  Human papillomavirus infection
zca05166  Human T-cell leukemia virus 1 infection
zca05167  Kaposi sarcoma-associated herpesvirus infection
zca05170  Human immunodeficiency virus 1 infection
zca05171  Coronavirus disease - COVID-19
zca05200  Pathways in cancer
zca05203  Viral carcinogenesis
zca05205  Proteoglycans in cancer
zca05206  MicroRNAs in cancer
zca05207  Chemical carcinogenesis - receptor activation
zca05208  Chemical carcinogenesis - reactive oxygen species
zca05210  Colorectal cancer
zca05211  Renal cell carcinoma
zca05212  Pancreatic cancer
zca05213  Endometrial cancer
zca05214  Glioma
zca05215  Prostate cancer
zca05216  Thyroid cancer
zca05218  Melanoma
zca05219  Bladder cancer
zca05220  Chronic myeloid leukemia
zca05221  Acute myeloid leukemia
zca05223  Non-small cell lung cancer
zca05224  Breast cancer
zca05225  Hepatocellular carcinoma
zca05226  Gastric cancer
zca05230  Central carbon metabolism in cancer
zca05231  Choline metabolism in cancer
zca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
zca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:zca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113933258 (MAPK3)
   04012 ErbB signaling pathway
    113933258 (MAPK3)
   04014 Ras signaling pathway
    113933258 (MAPK3)
   04015 Rap1 signaling pathway
    113933258 (MAPK3)
   04350 TGF-beta signaling pathway
    113933258 (MAPK3)
   04370 VEGF signaling pathway
    113933258 (MAPK3)
   04371 Apelin signaling pathway
    113933258 (MAPK3)
   04668 TNF signaling pathway
    113933258 (MAPK3)
   04066 HIF-1 signaling pathway
    113933258 (MAPK3)
   04068 FoxO signaling pathway
    113933258 (MAPK3)
   04072 Phospholipase D signaling pathway
    113933258 (MAPK3)
   04071 Sphingolipid signaling pathway
    113933258 (MAPK3)
   04024 cAMP signaling pathway
    113933258 (MAPK3)
   04022 cGMP-PKG signaling pathway
    113933258 (MAPK3)
   04151 PI3K-Akt signaling pathway
    113933258 (MAPK3)
   04150 mTOR signaling pathway
    113933258 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113933258 (MAPK3)
   04148 Efferocytosis
    113933258 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    113933258 (MAPK3)
   04210 Apoptosis
    113933258 (MAPK3)
   04218 Cellular senescence
    113933258 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    113933258 (MAPK3)
   04520 Adherens junction
    113933258 (MAPK3)
   04540 Gap junction
    113933258 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    113933258 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113933258 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    113933258 (MAPK3)
   04613 Neutrophil extracellular trap formation
    113933258 (MAPK3)
   04620 Toll-like receptor signaling pathway
    113933258 (MAPK3)
   04621 NOD-like receptor signaling pathway
    113933258 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    113933258 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    113933258 (MAPK3)
   04660 T cell receptor signaling pathway
    113933258 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    113933258 (MAPK3)
   04659 Th17 cell differentiation
    113933258 (MAPK3)
   04657 IL-17 signaling pathway
    113933258 (MAPK3)
   04662 B cell receptor signaling pathway
    113933258 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    113933258 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    113933258 (MAPK3)
   04062 Chemokine signaling pathway
    113933258 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    113933258 (MAPK3)
   04929 GnRH secretion
    113933258 (MAPK3)
   04912 GnRH signaling pathway
    113933258 (MAPK3)
   04915 Estrogen signaling pathway
    113933258 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    113933258 (MAPK3)
   04917 Prolactin signaling pathway
    113933258 (MAPK3)
   04921 Oxytocin signaling pathway
    113933258 (MAPK3)
   04926 Relaxin signaling pathway
    113933258 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    113933258 (MAPK3)
   04919 Thyroid hormone signaling pathway
    113933258 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    113933258 (MAPK3)
   04916 Melanogenesis
    113933258 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    113933258 (MAPK3)
   04270 Vascular smooth muscle contraction
    113933258 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    113933258 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    113933258 (MAPK3)
   04725 Cholinergic synapse
    113933258 (MAPK3)
   04726 Serotonergic synapse
    113933258 (MAPK3)
   04720 Long-term potentiation
    113933258 (MAPK3)
   04730 Long-term depression
    113933258 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    113933258 (MAPK3)
   04722 Neurotrophin signaling pathway
    113933258 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    113933258 (MAPK3)
   04380 Osteoclast differentiation
    113933258 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    113933258 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113933258 (MAPK3)
   05206 MicroRNAs in cancer
    113933258 (MAPK3)
   05205 Proteoglycans in cancer
    113933258 (MAPK3)
   05207 Chemical carcinogenesis - receptor activation
    113933258 (MAPK3)
   05208 Chemical carcinogenesis - reactive oxygen species
    113933258 (MAPK3)
   05203 Viral carcinogenesis
    113933258 (MAPK3)
   05230 Central carbon metabolism in cancer
    113933258 (MAPK3)
   05231 Choline metabolism in cancer
    113933258 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113933258 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    113933258 (MAPK3)
   05212 Pancreatic cancer
    113933258 (MAPK3)
   05225 Hepatocellular carcinoma
    113933258 (MAPK3)
   05226 Gastric cancer
    113933258 (MAPK3)
   05214 Glioma
    113933258 (MAPK3)
   05216 Thyroid cancer
    113933258 (MAPK3)
   05221 Acute myeloid leukemia
    113933258 (MAPK3)
   05220 Chronic myeloid leukemia
    113933258 (MAPK3)
   05218 Melanoma
    113933258 (MAPK3)
   05211 Renal cell carcinoma
    113933258 (MAPK3)
   05219 Bladder cancer
    113933258 (MAPK3)
   05215 Prostate cancer
    113933258 (MAPK3)
   05213 Endometrial cancer
    113933258 (MAPK3)
   05224 Breast cancer
    113933258 (MAPK3)
   05223 Non-small cell lung cancer
    113933258 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113933258 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    113933258 (MAPK3)
   05161 Hepatitis B
    113933258 (MAPK3)
   05160 Hepatitis C
    113933258 (MAPK3)
   05171 Coronavirus disease - COVID-19
    113933258 (MAPK3)
   05164 Influenza A
    113933258 (MAPK3)
   05163 Human cytomegalovirus infection
    113933258 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    113933258 (MAPK3)
   05165 Human papillomavirus infection
    113933258 (MAPK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    113933258 (MAPK3)
   05135 Yersinia infection
    113933258 (MAPK3)
   05133 Pertussis
    113933258 (MAPK3)
   05152 Tuberculosis
    113933258 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    113933258 (MAPK3)
   05140 Leishmaniasis
    113933258 (MAPK3)
   05142 Chagas disease
    113933258 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113933258 (MAPK3)
   05020 Prion disease
    113933258 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    113933258 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    113933258 (MAPK3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    113933258 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    113933258 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    113933258 (MAPK3)
   04934 Cushing syndrome
    113933258 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113933258 (MAPK3)
   01524 Platinum drug resistance
    113933258 (MAPK3)
   01522 Endocrine resistance
    113933258 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:zca01001]
    113933258 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:zca03036]
    113933258 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:zca04147]
    113933258 (MAPK3)
Enzymes [BR:zca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     113933258 (MAPK3)
Protein kinases [BR:zca01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   113933258 (MAPK3)
Chromosome and associated proteins [BR:zca03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     113933258 (MAPK3)
Exosome [BR:zca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   113933258 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 113933258
NCBI-ProteinID: XP_027468994
UniProt: A0A6J2EJ46
LinkDB
Position
10:96223256..96230046
AA seq 379 aa
MAAAAAQGGGGGEPRGADGVGPGVSGEVEVVKGQPFDVGPRYTELHYIGEGAYGMVSSAY
DHVRKIRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLEAMRDVYI
VQDLMETDLYKLLKSQQLSNDHVCYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDL
KICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLS
NRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSD
SKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDDLPKERL
KELIFQETARFQPGALEAP
NT seq 1140 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggctcaggggggcgggggcggggagccccggggagctgatggggtc
ggcccgggggtctcgggggaggtggaggtagtgaaggggcagccgttcgacgtgggcccc
cgctacacggagctgcattacatcggcgagggcgcgtacggcatggtcagctcagcttac
gaccacgtgcgcaagattcgcgtggccatcaagaaaatcagccccttcgagcatcagacc
tactgccagcgcacactgcgcgagattcagatcttgctgcgcttccgccatgagaacgtc
attggcattcgggacattctgcgggcgcccaccctggaagccatgagggatgtctacatc
gtgcaggacctgatggagacagacctctacaagttgctgaaaagccagcagctgagcaac
gaccatgtttgctacttcctctaccagatccttcgaggcctcaagtatatccactcagcc
aatgtgctccaccgggatttaaagccctctaacctgctcatcaacaccacctgcgacctt
aagatctgcgattttggcctggcccggattgccgatcccgagcatgaccacactggcttc
ctgacagaatatgtggccacacgctggtaccgggctccagaaatcatgcttaactctaag
ggctacaccaagtccatcgacatctggtctgtgggctgcattctggctgagatgctctcc
aaccggcccatcttccctggcaagcactacctggaccagctcaaccacattctgggtatc
ctgggctccccatcccaggaggacttgaattgtatcatcaatatgaaggcccgaaactac
ctgcagtctctgccctccaagaccaaggtggcctgggccaagctttttcccaagtcagac
tccaaagcccttgacctgctagaccggatgttgacctttaaccccaacaaacggatcaca
gtggaagaagcgctggctcacccctacttggagcagtactacgacccaacagatgagcca
gtggctgaggagcctttcaccttcgacatggagctggatgatctacccaaggaacggctg
aaggagctcatcttccaagagacagcccgcttccagcctggggcactggaggccccctaa

DBGET integrated database retrieval system