Zalophus californianus (California sea lion): 113936678
Help
Entry
113936678 CDS
T07874
Symbol
NOL3
Name
(RefSeq) nucleolar protein 3
KO
K28177
nucleolar protein 3
Organism
zca
Zalophus californianus (California sea lion)
Pathway
zca04210
Apoptosis
Brite
KEGG Orthology (KO) [BR:
zca00001
]
09140 Cellular Processes
09143 Cell growth and death
04210 Apoptosis
113936678 (NOL3)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
CARD
Trypan_PARP
Motif
Other DBs
NCBI-GeneID:
113936678
NCBI-ProteinID:
XP_027475971
UniProt:
A0A6J2F5X0
LinkDB
All DBs
Position
17:complement(18721032..18724586)
Genome browser
AA seq
206 aa
AA seq
DB search
MGNAQERPSETIDRERKRLVETLQADSGLLLDALLARGVLTGPEYEALDALPDAERRVRR
LLLLVQSKGEAACQELLHCAQRTTRAPDPAWDWQHVGTGYRERSYDTPCPGHWTPEAPSL
RTTCPEVPRASDCDEAGVPGGSEAVQSGTPGELNPELEAGASDEAGQDLEPEPEAEAEPE
PELEPDPEAEPEAEAGDEADDESEDS
NT seq
621 nt
NT seq
+upstream
nt +downstream
nt
atgggcaatgcgcaagagcggccctcagaaacgatcgatcgcgagcggaaacgcctggtg
gagacgctgcaggccgactccgggctgctgctggatgcactgttggcgcggggcgtgctc
accgggcccgagtacgaggcgctggacgcgctgccggatgccgagcgcagggtgcgccgc
ctgctgctgctggtgcagagcaagggcgaggccgcctgccaggagctgctgcattgcgcc
cagcggaccacgcgggcgcccgaccccgcctgggactggcagcacgtgggcaccggctac
cgggaacgcagctacgacactccatgccctggccactggacacccgaggcacctagcttg
aggaccacttgccccgaagtgcccagagcttcagactgcgacgaggctggggttcccggg
ggctccgaggcagtgcaatccggaacgcccggggaactcaatccggagctggaagctggg
gcctctgatgaggctgggcaggatttggaaccagaaccagaggcagaggcagaaccagaa
cctgaactggagccagatcccgaagccgagccagaggctgaggcgggtgacgaggcggat
gatgagtctgaagattcctga
DBGET
integrated database retrieval system