Zerene cesonia (dogface butterfly): 119830987 Help Entry 119830987         CDS       T07293                                  Name (RefSeq) bombyxin A-3 homolog   KO K04526   insulin Organism zce  Zerene cesonia (dogface butterfly) Pathway zce04068   FoxO signaling pathway zce04081   Hormone signaling zce04140   Autophagy - animal zce04150   mTOR signaling pathway zce04213   Longevity regulating pathway - multiple species Brite KEGG Orthology (KO) [BR:zce00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     119830987    04150 mTOR signaling pathway     119830987   09133 Signaling molecules and interaction    04081 Hormone signaling     119830987  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     119830987  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     119830987  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:zce04052]     119830987 Cytokines and neuropeptides [BR:zce04052]  Neuropeptides   Unclassified    119830987 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  119830987 NCBI-ProteinID:  XP_038210112 LinkDB All DBs Position 12:1162919..1164436 Genome browser AA seq 106 aa AA seqDB search MKSVAALALSCVSLLLIADTSVGQGQIYCGRRLAETLAYLCDNPLINRPGLIIKRTSYDT IMSDDFAWPWIPHRQAKGMRNKRQTVTSECCDKPCTLNELLTYCSY NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atgaagtcagtcgccgctcttgcgctatcttgtgtctcgcttcttctgattgcggacacg agcgttggacaagggcagatatattgcgggagacggctggcggaaacgctcgcgtacctt tgcgacaaccctctcataaacagaccaggtctgataataaaacgcacgagctacgacact ataatgtccgacgacttcgcctggccgtggatcccgcaccgtcaggcgaaggggatgaga aacaaacgccagaccgtcacctccgagtgttgcgacaaaccctgcactctcaacgaacta ttgacgtattgctcctattga

DBGET integrated database retrieval system