KEGG   Zerene cesonia (dogface butterfly): 119835297
Entry
119835297         CDS       T07293                                 
Name
(RefSeq) cytochrome P450 306a1 isoform X1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
zce  Zerene cesonia (dogface butterfly)
Pathway
zce00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:zce00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    119835297
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:zce00199]
    119835297
Enzymes [BR:zce01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     119835297
Cytochrome P450 [BR:zce00199]
 Cytochrome P450, animal type
  CYP306 family
   119835297
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 119835297
NCBI-ProteinID: XP_038215960
LinkDB
Position
20:6250814..6255187
AA seq 539 aa
MDFLFLWLVTFVLGFWICKKIKQWKDLPPGPWGLPVVGYLPFFDRLNPHLTLTKLAKDYG
PIYSIGMGSIYTVVLSDHKLIREAFAKDSFSGRAPLYLTHGIMHGNGIICAEGALWKDQR
KSITAWLKSFGMSKHSMSRDKLEKRIASGVYELLQNVKEASGTPVDLAEVVTNSLGNVVN
DIIFGYKFPPNDVTWQWFREIQEEGCHEMGVAGAVNFLPFLRFISPSIQKTIEVLVRGQA
QTHRLYASIVARRRKMLGIETPEQAVYAAHDDLFDQHPEGFIKCIKYSKYSVNTEEHYFD
PNVLIASEDECIVDNFLKEQKRRFESNEESAKYMTDEQMMYLLADMFGAGLDTTSVTLAW
YFLYMCIYPDEQERVRKEIMFECPDDSQIDISKLPYLMATICETQRIRSIVPVGIPHGCT
QDTYLGNYRIPKGTMVVPLQWAIHTDPNIWDDPNEFRPRRFIDDEGNLLKPQEFIPFQTG
KRMCPGDELSRMLSVGLIVRFLRCVRIRLASEPPSEEDLMGKVGLTLSPPKTTYICELI
NT seq 1620 nt   +upstreamnt  +downstreamnt
atggattttttatttctttggctggtaacttttgtcctaggcttctggatttgcaagaaa
ataaaacaatggaaagatttaccaccagggccatggggcctccctgtagttgggtattta
cccttttttgatcgtctcaacccccatctaacgttaacaaaattagcaaaagactatggt
ccaatctactccattggaatgggcagtatttatacggtcgtactttctgaccataagtta
atacgagaagcgtttgccaaagacagtttctctggacgcgcaccgttgtatttgacgcat
ggtattatgcatggaaatggtattatttgtgccgaaggagccctgtggaaagatcagcgc
aaatcgattacggcttggctcaagagtttcggtatgagtaaacacagtatgtctcgagat
aaattggagaagaggattgcttcaggcgtgtacgagctattacaaaacgtaaaggaagct
tcaggaacccctgttgatttggctgaagtagtgacaaattcactaggaaatgttgtaaac
gatattatttttggatacaaatttccaccaaacgacgtaacttggcaatggtttagagaa
atacaagaagaaggatgccatgaaatgggtgtagccggtgctgtcaatttccttccattc
cttcggtttatatcaccatccattcagaagaccatagaagttcttgtacgtggccaagct
caaactcatagactttacgcgagcatagtagctagacgtcgcaaaatgcttggaattgaa
acacccgaacaggctgtatacgcagcacacgatgatctttttgaccaacatcccgaaggc
tttatcaaatgtataaaatatagtaaatattctgttaacaccgaagaacattactttgat
ccaaatgttcttattgcgtccgaagatgaatgcattgttgacaatttccttaaagagcaa
aaacgaaggtttgaatcaaatgaagagtctgccaaatacatgacagatgaacaaatgatg
tatcttttagcggatatgttcggagctggtcttgatacaacgtcagtgacacttgcgtgg
tactttttgtacatgtgtatatatccagacgaacaggaacgcgtacgcaaagaaattatg
tttgaatgtcctgatgattctcaaatagatatttcaaaattgccttatttaatggcaacg
atatgcgagactcaaagaattcgctctattgttccagttggaataccccatggatgcaca
caagatacttatttgggtaattatcgtataccaaaaggaacaatggtggtgcctctccaa
tgggcgatacatacggatcctaatatttgggatgatcctaacgaattcagacctcggcgg
tttattgacgatgagggtaatctgttgaaaccgcaagagttcataccgtttcagacgggg
aagcgaatgtgccctggggatgaattatctagaatgctgtcagttggtctgattgtcaga
tttcttcgctgcgttagaatacgcctcgcatctgaaccaccgtcagaagaagatctcatg
ggcaaagttggactgaccctttctccacccaaaaccacgtatatatgtgagcttatatag

DBGET integrated database retrieval system