Zerene cesonia (dogface butterfly): 119836869 Help Entry 119836869         CDS       T07293                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism zce  Zerene cesonia (dogface butterfly) Pathway zce04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:zce00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     119836869  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:zce04121]     119836869    03400 DNA repair and recombination proteins [BR:zce03400]     119836869 Ubiquitin system [BR:zce04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      119836869    Cul5 complex      119836869 DNA repair and recombination proteins [BR:zce03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      119836869 SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  119836869 NCBI-ProteinID:  XP_038218242 LinkDB All DBs Position 3:8165230..8170230 Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRKKLTIFTDAKDTTTVLELKKMIEGILKVAPPSQMLFNKDSQLMEDEKTLAE YGLTSVTAKAQCPAPIGLALRKENGEFEALDLTPYSSPPDLPDVMKSQETNGQEQMDQH NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggatgtctttttaatgattaggcgaaaaaagttaaccatcttcacagatgcaaaggat actacgactgtactagaactgaaaaaaatgattgaaggtattctgaaagtggcaccgccc agtcaaatgttattcaataaggacagccagttgatggaggatgaaaagaccttagctgaa tatggtttgacctctgtgacagccaaagcacaatgccctgctcctattggacttgctcta aggaaagaaaatggtgaatttgaagccctggatctaaccccatactcctcccctccagat ctgccagacgtcatgaagtcccaggagacaaatggacaggaacaaatggatcagcattaa

DBGET integrated database retrieval system