Zobellella denitrificans: AN401_08920 Help Entry AN401_08920       CDS       T05100                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism zdf  Zobellella denitrificans Pathway zdf01100   Metabolic pathways zdf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:zdf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AN401_08920    00074 Mycolic acid biosynthesis     AN401_08920   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AN401_08920 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 HLH DUF1896 EutQ DUF1493 Motif Other DBs NCBI-ProteinID:  ATG73961 UniProt:  A0A231MWK4 LinkDB All DBs Position 1913127..1913363 Genome browser AA seq 78 aa AA seqDB search MSNIEERVKKIIVEQLGVKEEEVKPEASFVDDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINANQE NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaacatcgaagaacgcgtaaagaaaatcattgttgagcaactgggcgttaaggaa gaagaagtcaaacccgaagcctctttcgttgatgatctgggcgcggattccctggacacc gttgaactggtaatggctctggaagaagagttcgacaccgagattcctgacgaagaagcg gaaaagatcaccaccgttcaagccgcgattgattacatcaacgccaatcaggaataa

DBGET integrated database retrieval system