Zobellia galactanivorans: ZOBELLIA_2064 Help Entry ZOBELLIA_2064     CDS       T01586                                  Symbol acpP2 Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism zga  Zobellia galactanivorans Pathway zga01100   Metabolic pathways zga01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:zga00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ZOBELLIA_2064 (acpP2)    00074 Mycolic acid biosynthesis     ZOBELLIA_2064 (acpP2)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ZOBELLIA_2064 (acpP2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  CAZ96211 UniProt:  G0L5E4 LinkDB All DBs Position complement(2404406..2404663) Genome browser AA seq 85 aa AA seqDB search MSELKQELKEKIIEQLNLEDVSVDEIANNDPLFGEGLGLDSIDALELIVMLDKDYGIKLA DPKEGRKIFESIDTMAAYIAANRSN NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgagcgaacttaaacaagaattgaaggagaaaatcatcgagcaattaaacttggaagat gtttccgttgacgaaatcgcaaataacgacccgctttttggagagggtcttggtcttgac tctatcgatgcgctagagcttattgtaatgctcgacaaagattacggcattaaattggcc gacccgaaagaagggcgtaagatttttgagtctatcgataccatggccgcctatattgcg gcgaaccgatcgaactaa

DBGET integrated database retrieval system