Zobellia galactanivorans: ZOBELLIA_4383 Help Entry ZOBELLIA_4383     CDS       T01586                                  Symbol acpP4 Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism zga  Zobellia galactanivorans Pathway zga01100   Metabolic pathways zga01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:zga00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ZOBELLIA_4383 (acpP4)    00074 Mycolic acid biosynthesis     ZOBELLIA_4383 (acpP4)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ZOBELLIA_4383 (acpP4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 vRNAP_dom Motif Other DBs NCBI-ProteinID:  CAZ98518 UniProt:  G0L3M8 LinkDB All DBs Position complement(5099203..5099457) Genome browser AA seq 84 aa AA seqDB search MEEETKYNKLKDIIKVYLPEDVSVDAIGLESNFISELNINSANLVDIVLDVEDEFDIMLE NADMDKMQTVKDALGIIDAKLEAK NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atggaggaagagacaaagtacaataagctaaaagacattataaaggtgtatttgcccgaa gatgtttctgtcgatgccattggcttggaaagtaattttatcagtgagctcaatatcaat tcggccaatttggtagatattgtactcgatgtggaagacgagttcgatattatgttggag aatgccgacatggacaaaatgcaaaccgtaaaggatgcgctcggtattatcgacgccaaa cttgaagccaaataa

DBGET integrated database retrieval system