Ziziphus jujuba (Chinese jujube): 107410695 Help Entry 107410695         CDS       T04794                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism zju  Ziziphus jujuba (Chinese jujube) Brite KEGG Orthology (KO) [BR:zju00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:zju03041]     107410695   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:zju04052]     107410695 Spliceosome [BR:zju03041]  Complex B   Other components    Complex B specific factors     107410695 Cytokines and neuropeptides [BR:zju04052]  Neuropeptides   Unclassified    107410695 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 OTU1_UBXL Rad60-SLD Ubiquitin_4 Motif Other DBs NCBI-GeneID:  107410695 NCBI-ProteinID:  XP_015873644 UniProt:  A0A6P3ZHV6 LinkDB All DBs Position 10:6669028..6669249 Genome browser AA seq 73 aa AA seqDB search MIEVVLNDRLGKKVRVKCNDDDTIGDLKKLVAAQTGTRADKIRIQKWYNIYKDHITLKDY EIHDGMGLELYYN NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatagaggtggtgctgaacgatcgtctggggaagaaggtgagggtgaagtgcaacgac gacgacaccatcggagacctgaagaagctggtggcggctcagaccggcaccagagccgat aagatccgaattcagaagtggtacaacatctacaaggaccatattaccctcaaggactac gagatccacgatggcatgggtctcgagctctactacaactga

DBGET integrated database retrieval system