KEGG   Zonotrichia leucophrys gambelii (white-crowned sparrow): 135452748
Entry
135452748         CDS       T09958                                 
Symbol
GOT2
Name
(RefSeq) aspartate aminotransferase, mitochondrial
  KO
K14455  aspartate aminotransferase, mitochondrial [EC:2.6.1.1]
Organism
zle  Zonotrichia leucophrys gambelii (white-crowned sparrow)
Pathway
zle00220  Arginine biosynthesis
zle00250  Alanine, aspartate and glutamate metabolism
zle00270  Cysteine and methionine metabolism
zle00330  Arginine and proline metabolism
zle00350  Tyrosine metabolism
zle00360  Phenylalanine metabolism
zle00400  Phenylalanine, tyrosine and tryptophan biosynthesis
zle01100  Metabolic pathways
zle01200  Carbon metabolism
zle01210  2-Oxocarboxylic acid metabolism
zle01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:zle00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    135452748 (GOT2)
   00270 Cysteine and methionine metabolism
    135452748 (GOT2)
   00220 Arginine biosynthesis
    135452748 (GOT2)
   00330 Arginine and proline metabolism
    135452748 (GOT2)
   00350 Tyrosine metabolism
    135452748 (GOT2)
   00360 Phenylalanine metabolism
    135452748 (GOT2)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    135452748 (GOT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:zle01007]
    135452748 (GOT2)
Enzymes [BR:zle01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     135452748 (GOT2)
Amino acid related enzymes [BR:zle01007]
 Aminotransferase (transaminase)
  Class I
   135452748 (GOT2)
SSDB
Motif
Pfam: Aminotran_1_2
Other DBs
NCBI-GeneID: 135452748
NCBI-ProteinID: XP_064579204
LinkDB
Position
11:complement(7643613..7657045)
AA seq 449 aa
MRGAGRSAGARGVKCPPAAATTAAAAMALLHSRRLLAAPRLAAAASRASSWWSHVEMGPP
DPILGVTEAYKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASKKMDKEYLPIGG
LADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFKASRDVYLPKPS
WGNHTPIFRDAGMQLQAYRYYDPKTCSLDFSGAMDDISKIPEKSIILLHACAHNPTGVDP
RQEQWKELAATVKKRNLLVYFDMAYQGFASGDINRDAWAVRYFIEQGINIVLSQSFAKNM
GLYGERAGAFTVICSDPDEAKRVESQLKILIRPMYSNPPVNGARIASMILNTPDLRKEWL
TEVKGMADRIISMRTQLVSNLKKEGSSHNWQHITDQIGMFCFTGLKPEQVERLIKEFSVY
MTKDGRISVAGVTSGNVGYLAHAIHQVTK
NT seq 1350 nt   +upstreamnt  +downstreamnt
atgcgcggggcggggcgctcagccggcgcccgtggtgtgaagtgcccgcccgccgctgcc
accactgccgctgccgccatggcgctcctgcacagccgccggctcctcgccgccccgcgc
ctcgccgccgccgcctcccgcgccagctcatggtggtcccacgtggagatgggtcccccc
gaccccatcctgggggtgacagaagcttacaagcgtgacaccaactccaagaagatgaac
ctgggcgtgggggcgtatcgggatgacaacgggaagccctatgtcctgaactgtgttcgc
aaggcagaggccatgatagcatccaagaagatggataaggagtacctgcccattgggggc
ctggcggatttcacccgggcatccgcagagctggctctgggggaaaacagtgaggccttc
aagagcggccggtatgttactgtgcagggtatttctgggactggatctctgcgaattgga
gccaattttttgcaacgattcttcaaagccagccgtgatgtgtatctacccaaaccatcc
tggggcaaccacactcccattttccgtgatgctggcatgcagcttcaggcttatcgctac
tatgaccccaagacgtgcagccttgacttttctggagccatggatgacatttctaaaatt
ccagagaagagcatcatcctcttacatgcttgcgctcacaaccccactggggtggatccc
cggcaggagcagtggaaggagttggcagctacagtgaagaaacgaaacctcctcgtgtac
tttgacatggcctaccagggctttgccagcggggacatcaaccgggatgcctgggctgtg
cgctatttcatcgagcagggcatcaacatcgtcctgtcgcagtccttcgccaagaacatg
gggctgtacggagagcgtgcaggtgccttcacagtgatctgcagtgatccagatgaagcc
aagagggtcgagtcccagctgaagatcctcatccgccccatgtattccaacccacctgtg
aacggagctcgcattgcctccatgatcctgaacacccctgacctgcggaaggagtggctc
acagaggtgaagggcatggctgaccggatcatcagcatgaggactcagctggtgtccaac
ctcaagaaagagggatcctcccacaactggcagcacatcactgaccagatcggcatgttc
tgcttcacagggctgaagcctgagcaggtggagcggctgatcaaggagttctcagtgtac
atgacaaaggacggacgcatctctgtggcgggagttacgtcaggcaacgtgggttacctg
gcccatgccatccatcaagtcacaaagtaa

DBGET integrated database retrieval system