KEGG   Zea mays (maize): 100191283
Entry
100191283         CDS       T01088                                 

Name
(RefSeq) uncharacterized protein LOC100191283
  KO
K14271  nicotianamine aminotransferase [EC:2.6.1.80]
Organism
zma  Zea mays (maize)
Pathway
zma00997  Biosynthesis of various secondary metabolites - part 3
Brite
KEGG Orthology (KO) [BR:zma00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various secondary metabolites - part 3
    100191283
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:zma01007]
    100191283
Enzymes [BR:zma01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.80  nicotianamine aminotransferase
     100191283
Amino acid related enzymes [BR:zma01007]
 Aminotransferase (transaminase)
  Others
   100191283
SSDB
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase Aminotran_5 Cys_Met_Meta_PP Aminotran_3
Other DBs
NCBI-GeneID: 100191283
NCBI-ProteinID: NP_001130189
UniProt: B4F891
LinkDB
Position
5
AA seq 440 aa
MATHAGENGSGHENGGGHAEWRFARAAKEGALAVAGDKMSIRAVRFKISASLDARDPRPV
LPLAHGDPSVFPAFRTAAEAEDAVAAALRTGKFNCYPAGVGLPEARRALAEHLSSDLPYK
LSSDDIFVTAGGTQAIEVVVSVLAQPGTNILLPRPGYPNYEARAGLHNLEVRRFNLIPER
GWEIDIDGLESIADKNTTAMVIINPNNPCGSVYTREHLAKVAEVARKLGILVIADEVYGN
LVFGDTPFVPMGVFGHIAPVLTIGSLSKRWIVPGWRLGWVAVCDPNKVLQETKIIASITN
FLNVSTDPATFVQGALPHILKNTKEDFFKRIIGLLAETSEICFSGIKDIKCITCPHKPEG
SMFVMVKLNLYLLESIHDDIDFCCKLAKEESVILCPGSVLGMENWIRITFAIDSSSLLDG
LERLKSFCQRHKKKNLLNGH
NT seq 1323 nt   +upstreamnt  +downstreamnt
atggcgacccacgccggcgagaacggcagcgggcacgagaacggcggcgggcacgcggag
tggcggttcgcgcgggcggcgaaggagggcgcgctggccgttgcgggggacaagatgagc
atccgggcggtgcggttcaagatcagcgcgagcctggacgcgcgcgacccgcggcccgtg
ctgccgctggcgcacggggacccctcggtgttcccggccttccgcaccgccgccgaggcc
gaggacgccgtggccgccgcgctccggaccggcaagttcaactgctaccccgccggcgtc
ggcctccccgaagcccgccgtgctctggcggagcacctgtcgagcgaccttccatacaag
ctgtcgagcgacgacatcttcgtcaccgccggaggcacgcaagccatcgaggtggtggtc
tcagtcctcgcgcagccgggcaccaacatactgctcccgaggccgggctatccgaactac
gaggcgcgcgcagggctgcacaacctggaagttcgccggttcaatctgatccccgagaga
gggtgggagattgacatcgacggtctggagtcgatcgccgacaagaacaccaccgccatg
gtcatcataaaccccaacaacccttgcgggagtgtctacacccgagagcatttggccaag
gtcgcggaggtggcaaggaagcttggaatactggtcatcgctgatgaggtgtacggaaat
ctggtgtttggggacacccctttcgtccccatgggtgtctttggccacattgcccctgtg
ttgaccataggatcactgtccaagagatggatagtgcctgggtggcgacttggttgggtg
gccgtatgtgatcccaacaaggttctgcaagaaaccaagatcattgcatcgatcacaaac
ttccttaacgtttcaacagatccggcaacttttgttcagggagcgcttccccatattctt
aagaacacaaaggaagattttttcaagaggatcattggtctgctagcggaaacatcagag
atatgtttcagcggaataaaggacatcaagtgcatcacatgccctcacaagccagaaggt
tccatgtttgtcatggtgaaactaaatttgtatcttttggagagcatccatgatgatatt
gatttttgttgcaagctggcaaaagaagagtccgtgattttgtgtccagggagtgttttg
ggaatggaaaactggatccgtatcactttcgccattgattcatcttctcttcttgatggt
cttgagaggctgaaatctttctgccaaaggcataagaagaagaatttgcttaatggccat
taa

DBGET integrated database retrieval system