KEGG   Zea mays (maize): 100193424
Entry
100193424         CDS       T01088                                 

Name
(RefSeq) nicotianamine aminotransferase 1
  KO
K14271  nicotianamine aminotransferase [EC:2.6.1.80]
Organism
zma  Zea mays (maize)
Pathway
zma00997  Biosynthesis of various secondary metabolites - part 3
Brite
KEGG Orthology (KO) [BR:zma00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various secondary metabolites - part 3
    100193424
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:zma01007]
    100193424
Enzymes [BR:zma01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.80  nicotianamine aminotransferase
     100193424
Amino acid related enzymes [BR:zma01007]
 Aminotransferase (transaminase)
  Others
   100193424
SSDB
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase Aminotran_5 Cys_Met_Meta_PP Aminotran_3 Glyco_hydro_20
Other DBs
NCBI-GeneID: 100193424
NCBI-ProteinID: NP_001132018
UniProt: B4FEZ7
LinkDB
Position
4
AA seq 434 aa
MATHASDNGSGHAEWRFARAAKEGALAVAGDKMSIRAARFKISASVDGRDPRPVLPLAHG
DPSVFPAFRTAAEAEDAVAAALRTGKFNCYPAGVGLPEARRALAEHLSSDLPYKLSTDDI
FLTAGGTQAIEVVVSVLAQPGANILLPRPGYPNYEARAGLHNLQVRHFDLIPERGWEIDI
DSLESIADKNTTAMVIINPNNPCGSVYTREHLAKVAEVARKLGILVIADEVYGNLVFGDT
PYVPMGVFGHIAPVLSIGSLSKRWIVPGWRLGWVAVCDPNKILQETKIIASITNFLNVST
DPATFVQGALPHILGNTKEDFFRRIIGLLAETSEICYREIKDIKCITCPHKPEGSMFVMV
KLNLYLLEGIHDDIDFCCKLAKEESVILCPGSVLGMENWIRITFAIDSSSLLDGLERIKS
FCQRHKKKNLLNGH
NT seq 1305 nt   +upstreamnt  +downstreamnt
atggcgacccacgccagcgacaatggcagcgggcacgcggagtggcggttcgctcgggcg
gcgaaggagggtgcgctggccgtggccggggacaagatgagcatccgggcggcgcggttc
aagatcagcgcgagcgtggacgggcgcgacccgcggcccgtgctgccgcttgcgcacggg
gacccctcggtgttcccggccttccgcaccgccgccgaggccgaggacgccgtggccgcc
gcgctccggacgggcaagttcaactgctaccccgccggcgtgggcctccccgaagcccgc
cgtgctctggcggagcacctgtcaagtgatcttccatacaagctgtcaactgatgacatc
ttcctcaccgctggaggcactcaagccattgaggttgtcgtctcagtccttgcccaaccg
ggcgccaacatattgctcccaagaccaggctatccaaattatgaggcgcgtgcaggactg
cacaacttacaagttcgccatttcgatctgattcctgagagagggtgggaaatcgatatc
gactctctggagtcgattgctgacaagaacaccaccgcaatggtcatcataaaccccaac
aatccttgcggcagtgtctacacccgtgaacatttagccaaggtcgcggaggtagcaagg
aagcttggaatactagtcatcgctgatgaagtgtatggaaacctggtgtttggggacacc
ccttacgtcccaatgggtgtctttggccacattgcccctgtcttgagcataggatcacta
tcgaagaggtggatagtgcctgggtggcgacttggttgggtagctgtatgtgatcccaac
aagattctgcaagaaaccaagatcattgcatcaataacaaacttccttaacgtttcaact
gatccggcaacttttgttcagggagcacttccccatattcttgggaacacaaaggaagat
tttttcaggaggatcattggtctgctagcagaaacctcagagatatgttacagagaaata
aaggacatcaagtgcatcacctgccctcacaagccagaaggttccatgtttgtcatggtg
aaattaaatttgtatcttttggaggggattcatgacgatattgatttttgctgcaagctg
gcaaaagaagagtctgtgattttgtgtccagggagtgttttgggaatggaaaactggatc
cgcatcactttcgccattgattcatcttctcttcttgatggtcttgagaggatcaaatct
ttctgccaaaggcataagaagaagaatttgcttaatggccattaa

DBGET integrated database retrieval system