Zea mays (maize): 100240696 Help Entry 100240696         CDS       T01088                                  Symbol Atg8c Name (RefSeq) autophagy-related 8c   KO K08341   GABA(A) receptor-associated protein Organism zma  Zea mays (maize) Pathway zma04136   Autophagy - other Brite KEGG Orthology (KO) [BR:zma00001]  09140 Cellular Processes   09141 Transport and catabolism    04136 Autophagy - other     100240696 (Atg8c)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:zma04131]     100240696 (Atg8c)    04121 Ubiquitin system [BR:zma04121]     100240696 (Atg8c)    03029 Mitochondrial biogenesis [BR:zma03029]     100240696 (Atg8c) Membrane trafficking [BR:zma04131]  Autophagy   Autophagosome formation proteins    Atg8 conjugation proteins     100240696 (Atg8c) Ubiquitin system [BR:zma04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    100240696 (Atg8c) Mitochondrial biogenesis [BR:zma03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     100240696 (Atg8c) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATG8 APG12 Motif Other DBs NCBI-GeneID:  100240696 NCBI-ProteinID:  NP_001137494 UniProt:  B6SUL0 LinkDB All DBs Position 2:9335438..9338338 Genome browser AA seq 120 aa AA seqDB search MAKTSSFKLEHPLEKRQSEANRIREKYPDRIPVIVEKAERSDIPDIDKKKYLVPADLTVG QFVYVVRKRIKLSAEKAIFIFVKNTLPPTAALMSSIYEENKDEDGFLYMTYSGENTFGLL NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atggccaagacgagctcgttcaagctggagcacccccttgagaagaggcagtctgaggct aatcggatcagagagaagtaccctgacagaattccagtgattgttgagaaggctgagagg agtgacattcctgacatcgacaagaaaaagtacctggtccctgctgatcttacggttgga caattcgtgtatgttgttaggaagagaatcaagctcagtgctgagaaagctatcttcatc tttgtgaagaacacccttccaccaacagctgctctgatgtcttcaatctatgaagagaac aaggacgaggatgggttcctctacatgacctacagcggtgagaacaccttcgggctgctc tag

DBGET integrated database retrieval system