Zea mays (maize): 100280534 Help Entry 100280534         CDS       T01088                                  Name (RefSeq) delta DNA polymerase   KO K03505   DNA polymerase delta subunit 4 Organism zma  Zea mays (maize) Pathway zma03030   DNA replication zma03410   Base excision repair zma03420   Nucleotide excision repair zma03430   Mismatch repair zma03440   Homologous recombination Brite KEGG Orthology (KO) [BR:zma00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     100280534    03410 Base excision repair     100280534    03420 Nucleotide excision repair     100280534    03430 Mismatch repair     100280534    03440 Homologous recombination     100280534  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:zma03032]     100280534    03400 DNA repair and recombination proteins [BR:zma03400]     100280534 DNA replication proteins [BR:zma03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     100280534 DNA repair and recombination proteins [BR:zma03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       100280534    MMR (mismatch excision repair)     DNA polymerase delta complex      100280534 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol_delta_4 Nha1_C Motif Other DBs NCBI-GeneID:  100280534 NCBI-ProteinID:  NP_001146925 UniProt:  B6SHY6 LinkDB All DBs Position 10:76807197..76808275 Genome browser AA seq 129 aa AA seqDB search MTRGGGGDMKSFFRQQKTHAAAATTKPTGGVSKKAAAHHHKKAALATNVHPAPCTDPDHG AGSRQQEEAEAEQRERAGREFDMDTRYGPCLGVTRAQRWRRAAALGLAPPPALLALCADE QPCLWEGRV NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgacgaggggcggcggaggcgacatgaagtccttcttccgtcagcagaagacgcacgcc gccgccgccactaccaagcccactggcggcgtctccaagaaggcggcggcgcatcaccac aagaaggccgcactcgccaccaacgtccacccggccccatgtaccgatcccgatcacggc gccggcagccgccagcaggaggaggcggaggcggagcagcgggagagggcgggccgcgag ttcgacatggacacgcgctacgggccatgcctcggcgtcacccgcgcccagcggtggcgc cgcgccgccgcgctcggcctcgcaccgccgccggcgctcctcgccctctgcgccgacgaa cagccctgcctctgggagggccgcgtctag

DBGET integrated database retrieval system