Zea mays (maize): 100280740 Help Entry 100280740         CDS       T01088                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism zma  Zea mays (maize) Brite KEGG Orthology (KO) [BR:zma00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:zma03041]     100280740   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:zma04052]     100280740 Spliceosome [BR:zma03041]  Complex B   Other components    Complex B specific factors     100280740 Cytokines and neuropeptides [BR:zma04052]  Neuropeptides   Unclassified    100280740 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Rad60-SLD Ubiquitin_4 OTU1_UBXL Motif Other DBs NCBI-GeneID:  100280740 NCBI-ProteinID:  NP_001147132 UniProt:  B4FLL1 A0A8J8YEU7 LinkDB All DBs Position 2:complement(149321516..149324878) Genome browser AA seq 73 aa AA seqDB search MIEVVLNDRLGKKVRVKCNEDDTIGDLKKLVAAQTGTRPEKIRIQKWYNIYKDHITLKDY EIHDGMGLELYYN NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcgaggtggtgctgaacgaccgcctggggaagaaggtgcgggtgaagtgcaacgag gacgacaccatcggcgacctcaagaagctggtggcggcgcagacggggacgcgccccgag aagatccgcatccagaagtggtacaacatctacaaggaccacatcacgctcaaggactac gagatccacgacgggatggggctcgagctctactacaactag

DBGET integrated database retrieval system