Zea mays (maize): 103647693 Help Entry 103647693         CDS       T01088                                  Name (RefSeq) ubiquitin   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism zma  Zea mays (maize) Pathway zma03010   Ribosome zma04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:zma00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     103647693   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     103647693  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:zma03011]     103647693    04121 Ubiquitin system [BR:zma04121]     103647693   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:zma04147]     103647693 Ribosome [BR:zma03011]  Ribosomal proteins   Eukaryotes    Small subunit     103647693   Archaea     103647693 Ubiquitin system [BR:zma04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    103647693 Exosome [BR:zma04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103647693   Exosomal proteins of colorectal cancer cells    103647693 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD DUF2604 GABP-alpha Motif Other DBs NCBI-GeneID:  103647693 NCBI-ProteinID:  XP_020404968 LinkDB All DBs Position 2:207897212..207898679 Genome browser AA seq 86 aa AA seqDB search MQIFVNAITGTITLDAKSSDTIANIKAVVQDREGIPLDWQRLIFAGMQLEDDRTLADYCI QKESTLHLLPRLRGGGRGGYPLTSVP NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgcagatcttcgtgaacgcaattacggggaccatcacgctggatgccaagagcagcgac accatcgccaacatcaaggccgtggtccaagacagggaaggcatcccgctggactggcag cggctcatcttcgcagggatgcagctggaggatgaccgcaccctggccgactactgcatc cagaaggagtccacgctgcacctgctgccccgcctccgcggcggcggcaggggtggctac ccgctcaccagcgtcccgtag

DBGET integrated database retrieval system