Zea mays (maize): 103649123 Help Entry 103649123         CDS       T01088                                  Name (RefSeq) ras-related protein Rab7-like   KO K07897   Ras-related protein Rab-7A Organism zma  Zea mays (maize) Pathway zma04144   Endocytosis zma04145   Phagosome zma04148   Efferocytosis Brite KEGG Orthology (KO) [BR:zma00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     103649123    04145 Phagosome     103649123    04148 Efferocytosis     103649123  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:zma04131]     103649123   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:zma04147]     103649123    04031 GTP-binding proteins [BR:zma04031]     103649123 Membrane trafficking [BR:zma04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     103649123 Exosome [BR:zma04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103649123   Exosomal proteins of other body fluids (saliva and urine)    103649123   Exosomal proteins of colorectal cancer cells    103649123   Exosomal proteins of bladder cancer cells    103649123 GTP-binding proteins [BR:zma04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     103649123 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Motif Other DBs NCBI-GeneID:  103649123 NCBI-ProteinID:  XP_008671687 LinkDB All DBs Position 2:180313062..180314343 Genome browser AA seq 133 aa AA seqDB search LTLKFYHKFPSTRKTRKIATRRSFNTLDTWHDEFLNQAGPSDPQRFPFILVGNKIHSDGG SKRMVPEKKAREWCASKGDIPYFETSAKEDHNVDTAFLCIARLALEHEHDQDIYFKTVAE QVPDTEQTSRCAC NT seq 402 nt NT seq  +upstreamnt  +downstreamnt cttacattaaaattctaccacaaattcccatcaacaagaaaaacaagaaagatagctact aggagaagctttaatacgctcgatacctggcatgatgagttcctcaatcaagctggccca tcggatcctcagcgctttccgttcattttggtcgggaacaagattcattcagatggcggg agcaaacggatggttccggagaagaaagcgagggaatggtgcgcctccaagggcgatatt ccatacttcgagacctctgcgaaggaggaccacaacgtcgacactgctttcctatgcatc gctaggctcgccttggagcatgagcatgaccaagacatttacttcaagacagttgcagaa caagtcccggacactgaacagacaagcagatgtgcttgctag

DBGET integrated database retrieval system