Zea mays (maize): 109940504 Help Entry 109940504         CDS       T01088                                  Name (RefSeq) ras-related protein Rab7   KO K07897   Ras-related protein Rab-7A Organism zma  Zea mays (maize) Pathway zma04144   Endocytosis zma04145   Phagosome zma04148   Efferocytosis Brite KEGG Orthology (KO) [BR:zma00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     109940504    04145 Phagosome     109940504    04148 Efferocytosis     109940504  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:zma04131]     109940504   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:zma04147]     109940504    04031 GTP-binding proteins [BR:zma04031]     109940504 Membrane trafficking [BR:zma04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     109940504 Exosome [BR:zma04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    109940504   Exosomal proteins of other body fluids (saliva and urine)    109940504   Exosomal proteins of colorectal cancer cells    109940504   Exosomal proteins of bladder cancer cells    109940504 GTP-binding proteins [BR:zma04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     109940504 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Motif Other DBs NCBI-GeneID:  109940504 NCBI-ProteinID:  XP_020395640 LinkDB All DBs Position 6:113335610..113336745 Genome browser AA seq 129 aa AA seqDB search FCHRFPSTRKTRKIATRRSFNTLDTWHDEFLNQAGPSDPQRFPFILVGNKIDLDGGSKRM VLEKKVREWCASKGDIPYFETSAKEDHNIDTAFLCIARLALEHEHDQDIYFKTVAEQVPD TKQTSGCAS NT seq 390 nt NT seq  +upstreamnt  +downstreamnt ttctgccacagattcccatcaacaagaaaaacaagaaagatagctactaggagaagcttt aatacgctcgatacctggcatgatgagttcctcaatcaagctggcccatcggatcctcag cgctttccgttcattttggtcgggaacaagattgatttagatggcgggagcaaacggatg gttctggagaagaaagtgagggaatggtgcgcctctaagggcgatattccatacttcgag acctctgcgaaggaggaccacaacatcgatactgctttcctatgcatcgctaggctcgcc ttggagcatgagcatgaccaagacatttacttcaagacagttgcggaacaagtcccggac actaaacagacaagcggatgtgcttcctag

DBGET integrated database retrieval system