KEGG   Zea mays (maize): 118474115
Entry
118474115         CDS       T01088                                 
Name
(RefSeq) SKP1-like protein 1
  KO
K03094  S-phase kinase-associated protein 1
Organism
zma  Zea mays (maize)
Pathway
zma03083  Polycomb repressive complex
zma04120  Ubiquitin mediated proteolysis
zma04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:zma00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    118474115
   04120 Ubiquitin mediated proteolysis
    118474115
  09126 Chromosome
   03083 Polycomb repressive complex
    118474115
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:zma04131]
    118474115
   04121 Ubiquitin system [BR:zma04121]
    118474115
   03036 Chromosome and associated proteins [BR:zma03036]
    118474115
Membrane trafficking [BR:zma04131]
 Endosome - Lysosome transport
  Acidification regulators
   RAVE complex
    118474115
Ubiquitin system [BR:zma04121]
 Ubiquitin ligases (E3)
  Multi subunit type E3
   SCF complex
    Adaptor protein
     118474115
   Cul7 complex
     118474115
Chromosome and associated proteins [BR:zma03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb repressive complex (PRC) and associated proteins
    Noncanonical PRC1 (PRC1.1)
     118474115
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     118474115
SSDB
Motif
Pfam: Skp1_POZ Skp1
Other DBs
NCBI-GeneID: 118474115
NCBI-ProteinID: XP_035819596
UniProt: A0A096UBK9
LinkDB
Position
Unknown
AA seq 192 aa
MAEKKMLTLRSSDCEEFEVEEAVLMKSEIIRFMIEDDCADNVIPLANVNSKTLALVIEYC
NKHVHADAAETTSASSAGGGGEVDLKKWDAEFVKVAPATLFDLIMAANYLDIKGLQGLTC
RAVVDMIQGKSPEEIRKTFNIKNDLTKEEEDAIRSENSWAFDPLPVRSSGPRWLLLALIS
IASLLVCSYLLI
NT seq 579 nt   +upstreamnt  +downstreamnt
atggctgagaagaagatgcttacgctgaggagctccgactgcgaggagttcgaggtggag
gaggcggtgttgatgaagtcagagatcattcgcttcatgatcgaggacgactgcgccgac
aacgtcatcccgctcgccaacgtgaattccaagactctcgccctggtcatcgagtactgc
aacaagcacgtccacgccgacgccgcggagaccaccagcgcctcatcagctgggggcggc
ggcgaggtcgacctcaagaagtgggacgcggagttcgtcaaggtcgcgccggcgacgctc
ttcgacctcatcatggctgccaactatctcgacatcaaggggttgcagggcctgacctgc
cgggcggtggtcgacatgatccagggcaagtcaccggaggagatccgcaagaccttcaac
atcaagaacgacttaaccaaagaggaggaggacgcgatccgtagcgagaactcctgggcc
ttcgacccgctccccgtccgtagtagtggaccgcggtggttactgttagctttgatctcg
attgctagtttgctcgtctgcagttatcttctgatctga

DBGET integrated database retrieval system