Zea mays (maize): 118476267
Help
Entry
118476267 CDS
T01088
Name
(RefSeq) SKP1-like protein 1
KO
K03094
S-phase kinase-associated protein 1
Organism
zma
Zea mays (maize)
Pathway
zma03083
Polycomb repressive complex
zma04120
Ubiquitin mediated proteolysis
zma04141
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:
zma00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
04141 Protein processing in endoplasmic reticulum
118476267
04120 Ubiquitin mediated proteolysis
118476267
09126 Chromosome
03083 Polycomb repressive complex
118476267
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:
zma04131
]
118476267
04121 Ubiquitin system [BR:
zma04121
]
118476267
03036 Chromosome and associated proteins [BR:
zma03036
]
118476267
Membrane trafficking [BR:
zma04131
]
Endosome - Lysosome transport
Acidification regulators
RAVE complex
118476267
Ubiquitin system [BR:
zma04121
]
Ubiquitin ligases (E3)
Multi subunit type E3
SCF complex
Adaptor protein
118476267
Cul7 complex
118476267
Chromosome and associated proteins [BR:
zma03036
]
Eukaryotic type
Histone modification proteins
Polycomb repressive complex (PRC) and associated proteins
Noncanonical PRC1 (PRC1.1)
118476267
Centromeric chromatin formation proteins
Kinetochore proteins
CBF3 complex
118476267
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Skp1_POZ
Motif
Other DBs
NCBI-GeneID:
118476267
NCBI-ProteinID:
XP_035820995
LinkDB
All DBs
Position
2:complement(234884086..234884632)
Genome browser
AA seq
159 aa
AA seq
DB search
MGEKKMLTLRSSDCEEFEVEEAVLMKSEIIRFMIEDDCSDNVIPLPNVNSKTLALVIEYC
NKHVHDAAKPADAAETTNASSAGGGGEVDLKKWDAEFGKVAPATLFDRVELPFFIRVELP
FFDPIRATRMPKMKESEKRKTRFDKGITLNKSADPPMND
NT seq
480 nt
NT seq
+upstream
nt +downstream
nt
atgggtgagaagaagatgcttacgctgaggagctccgactgcgaggagttcgaggtggag
gaggcggtgttgatgaagtcagagatcattcgcttcatgatcgaggacgactgctccgac
aacgtcatcccgctccccaacgtcaattccaagactctcgccctagtcatcgagtactgc
aacaagcacgtccacgacgccgccaagcccgccgacgccgcggagaccaccaacgcctca
tcagctgggggcggcggcgaggtcgacctcaaaaagtgggacgcggagttcggcaaggtt
gcgccggcgacgctcttcgacagagtagagctgccattcttcatcagagtagagctgcca
ttctttgatccaattagggccaccagaatgccaaagatgaaggaaagcgagaagcgaaaa
acccggttcgacaaaggaataaccctaaataaatccgctgatccaccaatgaacgattga
DBGET
integrated database retrieval system