Zea mays (maize): 541774 Help Entry 541774            CDS       T01088                                  Name (RefSeq) Rop3 small GTP binding protein   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism zma  Zea mays (maize) Pathway zma04145   Phagosome zma04148   Efferocytosis zma04517   IgSF CAM signaling zma04518   Integrin signaling zma04620   Toll-like receptor signaling pathway zma05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:zma00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     541774    04518 Integrin signaling     541774  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     541774    04148 Efferocytosis     541774  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     541774  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     541774  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:zma04131]     541774   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:zma04147]     541774    04031 GTP-binding proteins [BR:zma04031]     541774 Membrane trafficking [BR:zma04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     541774  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     541774   Macropinocytosis    Ras GTPases     541774  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     541774 Exosome [BR:zma04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    541774   Exosomal proteins of other body fluids (saliva and urine)    541774   Exosomal proteins of colorectal cancer cells    541774   Exosomal proteins of bladder cancer cells    541774 GTP-binding proteins [BR:zma04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     541774 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  541774 NCBI-ProteinID:  NP_001104930 UniProt:  B4FMM2 LinkDB All DBs Position 6:143724401..143727718 Genome browser AA seq 217 aa AA seqDB search MSAAAASSVTKFIKCVTVGDGAVGKTCMLICYTCNKFPTDYIPTVFDNFSANVSVGGSIV NLGLWDTAGQEDYSRLRPLSYRGADVFILSFSLVSRASYENVLKKWMPELRRFSPTVPVV LVGTKLDLREDRSYLADHSAASIISTEQGEELRKQIGAVAYIECSSKTQRNVKAVFDTAI KVVLQPPRRREVTRKKMKARSNQSLRRYLCGSGCFTS NT seq 654 nt NT seq  +upstreamnt  +downstreamnt atgagcgcggcggcggcgagctcggtcaccaagttcatcaagtgcgtcacggtcggcgat ggggccgtcgggaagacctgcatgctcatctgctacacctgcaacaagttccccacggat tatatccccaccgtatttgacaacttcagcgccaatgtctccgtgggtgggagcatcgtt aacttgggcctctgggacacggcaggccaggaggattacagcaggttgaggcctctcagc tacaggggtgccgatgtgttcatcctctccttctccctggtcagcagggcgagctatgag aacgtcctcaagaagtggatgccagagcttcgccgattttcacctactgttcctgtagtt cttgttggaaccaaactagatctccgtgaagacagatcttaccttgctgaccattctgct gcttccatcatctctactgaacagggagaagagctcaggaagcagataggcgctgtggcg tacatagaatgcagctcaaagacacagaggaacgtaaaggctgtgttcgacactgcaatt aaagtagtgctgcaaccaccgaggagaagagaagttaccaggaagaaaatgaaggcaagg tcgaatcagtctctgagaagatacctctgtggaagcggatgtttcacatcgtaa

DBGET integrated database retrieval system