Zea mays (maize): 541774 Help Entry 541774            CDS       T01088                                  Name (RefSeq) Rop3 small GTP binding protein   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism zma  Zea mays (maize) Pathway zma04145   Phagosome zma04148   Efferocytosis zma04620   Toll-like receptor signaling pathway zma05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:zma00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     541774    04148 Efferocytosis     541774  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     541774  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     541774  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:zma04131]     541774   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:zma04147]     541774    04031 GTP-binding proteins [BR:zma04031]     541774 Membrane trafficking [BR:zma04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     541774  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     541774   Macropinocytosis    Ras GTPases     541774  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     541774 Exosome [BR:zma04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    541774   Exosomal proteins of other body fluids (saliva and urine)    541774   Exosomal proteins of colorectal cancer cells    541774   Exosomal proteins of bladder cancer cells    541774 GTP-binding proteins [BR:zma04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     541774 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  541774 NCBI-ProteinID:  NP_001104930 UniProt:  B4FMM2 LinkDB All DBs Position 6:143724401..143727718 Genome browser AA seq 217 aa AA seqDB search MSAAAASSVTKFIKCVTVGDGAVGKTCMLICYTCNKFPTDYIPTVFDNFSANVSVGGSIV NLGLWDTAGQEDYSRLRPLSYRGADVFILSFSLVSRASYENVLKKWMPELRRFSPTVPVV LVGTKLDLREDRSYLADHSAASIISTEQGEELRKQIGAVAYIECSSKTQRNVKAVFDTAI KVVLQPPRRREVTRKKMKARSNQSLRRYLCGSGCFTS NT seq 654 nt NT seq  +upstreamnt  +downstreamnt atgagcgcggcggcggcgagctcggtcaccaagttcatcaagtgcgtcacggtcggcgat ggggccgtcgggaagacctgcatgctcatctgctacacctgcaacaagttccccacggat tatatccccaccgtatttgacaacttcagcgccaatgtctccgtgggtgggagcatcgtt aacttgggcctctgggacacggcaggccaggaggattacagcaggttgaggcctctcagc tacaggggtgccgatgtgttcatcctctccttctccctggtcagcagggcgagctatgag aacgtcctcaagaagtggatgccagagcttcgccgattttcacctactgttcctgtagtt cttgttggaaccaaactagatctccgtgaagacagatcttaccttgctgaccattctgct gcttccatcatctctactgaacagggagaagagctcaggaagcagataggcgctgtggcg tacatagaatgcagctcaaagacacagaggaacgtaaaggctgtgttcgacactgcaatt aaagtagtgctgcaaccaccgaggagaagagaagttaccaggaagaaaatgaaggcaagg tcgaatcagtctctgagaagatacctctgtggaagcggatgtttcacatcgtaa

DBGET integrated database retrieval system