Zea mays (maize): 541930 Help Entry 541930            CDS       T01088                                  Name (RefSeq) GTPase protein   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism zma  Zea mays (maize) Pathway zma04145   Phagosome zma04148   Efferocytosis zma04517   IgSF CAM signaling zma04518   Integrin signaling zma04620   Toll-like receptor signaling pathway zma05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:zma00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     541930    04518 Integrin signaling     541930  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     541930    04148 Efferocytosis     541930  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     541930  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     541930  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:zma04131]     541930   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:zma04147]     541930    04031 GTP-binding proteins [BR:zma04031]     541930 Membrane trafficking [BR:zma04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     541930  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     541930   Macropinocytosis    Ras GTPases     541930  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     541930 Exosome [BR:zma04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    541930   Exosomal proteins of other body fluids (saliva and urine)    541930   Exosomal proteins of colorectal cancer cells    541930   Exosomal proteins of bladder cancer cells    541930 GTP-binding proteins [BR:zma04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     541930 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  541930 NCBI-ProteinID:  NP_001105063 UniProt:  Q94JP1 A0A8J8XST2 LinkDB All DBs Position 4:187512064..187515917 Genome browser AA seq 214 aa AA seqDB search MASSASRFIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVDGTTVNLGL WDTAGQEDYNRLRPLSYRGADVFVLAFSLVSRASYENIMKKWIPELQHYARGVPVVLVGT KFDLREDKHYLMDHPGLVPVTTAQGEELRRQIGAMYYIECSSKTQQNVKAVFDAAIKVVI QPPTKLREKKKKKSRKGCSMVNILSGRKMLCFKS NT seq 645 nt NT seq  +upstreamnt  +downstreamnt atggcgtccagcgcctctcggttcatcaagtgcgtcacggtcggcgacggtgccgtgggc aagacatgtatgctcatctgctacaccagcaacaagttccccactgattacatacccacg gtgttcgacaatttcagtgcaaatgtcgttgtggatggcaccacggtgaatttgggcctg tgggataccgcagggcaggaagattacaaccgactgaggcctctaagctaccgtggtgca gatgttttcgtgcttgcattctcacttgtgagtcgagctagctatgagaatatcatgaag aagtggataccggagcttcagcattatgcacgtggggtgcctgttgtgttggtaggcaca aaatttgatcttcgtgaagacaagcactacttgatggaccatcctgggttggtgcctgtt accacagcacaaggggaggaacttcgtagacaaattggtgctatgtattacatcgaatgc agttcgaagacacagcagaatgtcaaagctgtgttcgatgctgccatcaaggttgtaatc cagcctccaactaaactaagagaaaagaagaaaaagaaatcacgcaagggatgttcgatg gtgaacatcttatctggaagaaaaatgctatgcttcaagtcctga

DBGET integrated database retrieval system