Zea mays (maize): 541930 Help Entry 541930            CDS       T01088                                  Name (RefSeq) GTPase protein   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism zma  Zea mays (maize) Pathway zma04145   Phagosome zma04148   Efferocytosis zma04620   Toll-like receptor signaling pathway zma05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:zma00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     541930    04148 Efferocytosis     541930  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     541930  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     541930  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:zma04131]     541930   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:zma04147]     541930    04031 GTP-binding proteins [BR:zma04031]     541930 Membrane trafficking [BR:zma04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     541930  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     541930   Macropinocytosis    Ras GTPases     541930  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     541930 Exosome [BR:zma04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    541930   Exosomal proteins of other body fluids (saliva and urine)    541930   Exosomal proteins of colorectal cancer cells    541930   Exosomal proteins of bladder cancer cells    541930 GTP-binding proteins [BR:zma04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     541930 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  541930 NCBI-ProteinID:  NP_001105063 UniProt:  Q94JP1 A0A8J8XST2 LinkDB All DBs Position 4:187512064..187515917 Genome browser AA seq 214 aa AA seqDB search MASSASRFIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVDGTTVNLGL WDTAGQEDYNRLRPLSYRGADVFVLAFSLVSRASYENIMKKWIPELQHYARGVPVVLVGT KFDLREDKHYLMDHPGLVPVTTAQGEELRRQIGAMYYIECSSKTQQNVKAVFDAAIKVVI QPPTKLREKKKKKSRKGCSMVNILSGRKMLCFKS NT seq 645 nt NT seq  +upstreamnt  +downstreamnt atggcgtccagcgcctctcggttcatcaagtgcgtcacggtcggcgacggtgccgtgggc aagacatgtatgctcatctgctacaccagcaacaagttccccactgattacatacccacg gtgttcgacaatttcagtgcaaatgtcgttgtggatggcaccacggtgaatttgggcctg tgggataccgcagggcaggaagattacaaccgactgaggcctctaagctaccgtggtgca gatgttttcgtgcttgcattctcacttgtgagtcgagctagctatgagaatatcatgaag aagtggataccggagcttcagcattatgcacgtggggtgcctgttgtgttggtaggcaca aaatttgatcttcgtgaagacaagcactacttgatggaccatcctgggttggtgcctgtt accacagcacaaggggaggaacttcgtagacaaattggtgctatgtattacatcgaatgc agttcgaagacacagcagaatgtcaaagctgtgttcgatgctgccatcaaggttgtaatc cagcctccaactaaactaagagaaaagaagaaaaagaaatcacgcaagggatgttcgatg gtgaacatcttatctggaagaaaaatgctatgcttcaagtcctga

DBGET integrated database retrieval system