Zea mays (maize): 542420 Help Entry 542420            CDS       T01088                                  Name (RefSeq) calmodulin   KO K02183   calmodulin Organism zma  Zea mays (maize) Pathway zma04016   MAPK signaling pathway - plant zma04070   Phosphatidylinositol signaling system zma04075   Plant hormone signal transduction zma04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:zma00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     542420    04070 Phosphatidylinositol signaling system     542420    04075 Plant hormone signal transduction     542420  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     542420  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:zma01009]     542420   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:zma04131]     542420    03036 Chromosome and associated proteins [BR:zma03036]     542420   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:zma04147]     542420 Protein phosphatases and associated proteins [BR:zma01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      542420 Membrane trafficking [BR:zma04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     542420 Chromosome and associated proteins [BR:zma03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      542420 Exosome [BR:zma04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    542420 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH SPARC_Ca_bdg EF_EFCAB10_C EF-hand_11 UPF0154 DUF5580_M Dockerin_1 EFhand_Ca_insen RNA_pol_Rpb4 Caleosin MotA_activ SPEF2_C FCaBP_EF-hand SurA_N_3 PA_Ig-like DUF6279 Fe_hyd_lg_C MecA_N Motif Other DBs NCBI-GeneID:  542420 NCBI-ProteinID:  NP_001281081 UniProt:  B4FBW7 A0A8J8XTV7 LinkDB All DBs Position 1:51978656..51982056 Genome browser AA seq 149 aa AA seqDB search MADQLTDDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE EVDEMIREADVDGDGQINYEEFVKVMMAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcggaccagctcaccgacgaccagatcgccgagttcaaggaggccttcagcctcttc gacaaggacggcgacggttgcatcacaaccaaggagctcggaactgtcatgcgatcactg ggtcagaacccaaccgaggctgagctccaggacatgatcaacgaggtcgatgcggacggc aacggcaccatcgacttcccggagttcctcaacctcatggcccgcaagatgaaggacacc gactccgaggaggagctcaaggaggcgttcagggtgttcgacaaggaccagaacggcttc atctctgcggcggagctccgccacgtgatgaccaacctcggcgagaagctgaccgacgag gaggtcgatgagatgatccgcgaggccgacgtcgatggtgatggccagatcaactacgag gagttcgtcaaggtcatgatggccaagtga

DBGET integrated database retrieval system