Zea mays (maize): 606468 Help Entry 606468            CDS       T01088                                  Name (RefSeq) calmodulin-like protein 4   KO K02183   calmodulin Organism zma  Zea mays (maize) Pathway zma04016   MAPK signaling pathway - plant zma04070   Phosphatidylinositol signaling system zma04075   Plant hormone signal transduction zma04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:zma00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     606468    04070 Phosphatidylinositol signaling system     606468    04075 Plant hormone signal transduction     606468  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     606468  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:zma01009]     606468   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:zma04131]     606468    03036 Chromosome and associated proteins [BR:zma03036]     606468   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:zma04147]     606468 Protein phosphatases and associated proteins [BR:zma01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      606468 Membrane trafficking [BR:zma04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     606468 Chromosome and associated proteins [BR:zma03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      606468 Exosome [BR:zma04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    606468 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EF_EFCAB10_C EH SPARC_Ca_bdg Dockerin_1 DUF5580_M EF-hand_11 Caleosin RNA_pol_Rpb4 UPF0154 SurA_N_3 TerB MTIP_N PA_Ig-like DUF2267 Motif Other DBs NCBI-GeneID:  606468 NCBI-ProteinID:  NP_001288374 UniProt:  B6TGU5 LinkDB All DBs Position 1:281720679..281723152 Genome browser AA seq 154 aa AA seqDB search MDGLTDEQRLAFQEAFSLFDKNGDGCITMEELAAVTRSLGLDPSDQELNDMMSEVDTDGN GIIDFQEFLSLIARKMKDGDGDEELKEAFEVLDKDQNGFISPVELRTVMTSLGEKMTDEE VEQMIREADTDGDGQVNYDEFVLMMKNAERKISG NT seq 465 nt NT seq  +upstreamnt  +downstreamnt atggacgggctgacggacgagcagaggctcgcgttccaggaggccttctcgctcttcgac aagaacggcgacggatgcatcaccatggaagagctggccgcagtcacccgttccctcggt ctcgacccgagcgatcaggagctcaatgatatgatgagcgaggtcgatacggacggcaat gggatcatcgatttccaggagttcttaagcctcattgcccggaagatgaaggatggcgac ggcgacgaagagctcaaggaagcctttgaggtcctggacaaagaccagaacggcttcatc tccccggttgagctgaggacggtgatgaccagtctcggggagaagatgaccgacgaggag gttgaacagatgatcagggaagcagacaccgacggtgacggtcaggtgaactacgatgag ttcgttctcatgatgaagaacgctgagcggaaaatatctgggtga

DBGET integrated database retrieval system