Zygotorulaspora mrakii: HG535_0H03100 Help Entry HG535_0H03100     CDS       T06976                                  Name (RefSeq) uncharacterized protein   KO K11511   centromere protein S Organism zmk  Zygotorulaspora mrakii Pathway zmk03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:zmk00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     HG535_0H03100  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:zmk03036]     HG535_0H03100    03400 DNA repair and recombination proteins [BR:zmk03400]     HG535_0H03100 Chromosome and associated proteins [BR:zmk03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      HG535_0H03100 DNA repair and recombination proteins [BR:zmk03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      HG535_0H03100 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-S CENP-T_C Bromo_TP Histone TFIID-31kDa TFIID-18kDa PCP_red Motif Other DBs NCBI-GeneID:  59238786 NCBI-ProteinID:  XP_037146708 UniProt:  A0A7H9B8Y1 LinkDB All DBs Position 8:complement(616670..616951) Genome browser AA seq 93 aa AA seqDB search MNDEDAKLTSNLKGKLWYCVERQVDEETPFDTRHTPQFINALVELTYVQLSEMGKDLEAF ARHAGRDTITSDDMMLLLRKTPTLQDIIRPKAN NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgaatgatgaagatgcaaaattgaccagtaatttgaagggaaagctctggtattgtgta gaacgtcaagtcgacgaagagacaccctttgacactcgccatacaccacagtttattaat gcccttgtcgaactgacttatgttcagttgagtgaaatgggtaaggacctcgaggcattt gcaagacatgcgggaagagacacgatcaccagcgatgacatgatgctattgctgagaaag acgccaactcttcaagatattataagaccaaaagcaaattag

DBGET integrated database retrieval system