KEGG   Zootermopsis nevadensis (dampwood termite): 110827511
Entry
110827511         CDS       T05136                                 
Name
(RefSeq) cytochrome P450 306a1 isoform X1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
zne  Zootermopsis nevadensis (dampwood termite)
Pathway
zne00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:zne00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    110827511
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:zne00199]
    110827511
Enzymes [BR:zne01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     110827511
Cytochrome P450 [BR:zne00199]
 Cytochrome P450, animal type
  CYP306 family
   110827511
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 110827511
NCBI-ProteinID: XP_021914923
LinkDB
Position
Unknown
AA seq 517 aa
MPGSRNDSEESSTMDVDVSLVFTALLLLCASAFATLLYVHRRGPRLPPGPHGLPIVGFLP
WIDPNAPHLTLTRLVKDYGRIYTLKLGSVLTVVLSDHRLIREAFAKDIFTGRAPLFLTHG
IMNGYGLICAEGELWKDQRKFVTTCLKTLGMVKFGARRERMENRISVGVQKCLEMLQQKE
TAGEPQDVLPVIIHCIGNVINSLVFGIVYEENDPTWKWLQRLQEEGTKLIGIAGPVNFLP
FVRFLPKYKKHMHYLLGGKVKTHDYYQTIIHDHMKRRKSTPDDGANSPIDDIIDAFLDEK
ERRGEGEDGLYSTPQLHHLLSDMFGAGVDTTMTTLWWFILFMAGHPDAQKRAQEELDDVV
GTRLPTLDDLPLLPYTEAALSETQRIRSVVPVGIPHGTYEATTLGGYHIPKGAMIVPLQW
AVHMDPNYWSKPECFNPERFLTHDGRFNKPEFFIPFQTGKRMCVGEELARMLLFLFGATI
IHKFNIKAPEGVDVDLEGICGITLTPKHQRLLFSPRF
NT seq 1554 nt   +upstreamnt  +downstreamnt
atgccaggatcacgtaacgacagtgaagaatcaagtacgatggacgtagacgtgtcattg
gttttcacagctttgctgttgctctgcgcatccgccttcgcaacgctgctgtatgtacac
cgccgaggaccacgtcttccaccaggtccccatggtctgcctatagtgggcttcttacct
tggattgacccaaatgctcctcatctgaccctcactcgcctagttaaagactacggtcgc
atctacacgctgaagttggggagtgtgttgacagtagttttatcggaccatcgccttatc
agagaagcatttgctaaggacatctttacaggacgagccccgctttttctcactcatgga
atcatgaatggctatggattgatttgtgctgaaggcgaactatggaaagaccagcgtaaa
tttgttacaacatgcctgaagaccttaggcatggttaaatttggcgctagaagggaaaga
atggagaacagaatatctgttggcgtgcaaaagtgccttgagatgcttcagcaaaaggag
actgcaggggaacctcaggacgttctcccagtgataattcattgtataggaaacgtgata
aactcattagtttttggtattgtctatgaagaaaatgatcccacgtggaaatggttgcag
cgtctccaggaagaaggcacaaaacttatcggcattgctggacctgtaaattttctgcca
tttgtaaggttccttccgaagtataagaagcatatgcattatttgcttggagggaaagtg
aaaacccatgattattatcagaccatcatacacgatcacatgaagagacgtaagtcgacc
ccagacgacggagcaaattctccaatagacgatataatcgacgcttttctagacgagaaa
gagcggcgcggagagggagaggatggtttatacagcacccctcagttgcaccatctgctg
tcagacatgtttggtgccggagtggacaccaccatgaccacactgtggtggtttatcctc
ttcatggccggtcaccccgatgcacagaagagggcacaggaagaattagacgatgttgtt
ggtacccgcctgcctactctggatgatctcccactactaccatacactgaagcagctctt
tccgagacacaaaggatccgatctgttgtcccagttggaatacctcacggaacatatgag
gctactaccctaggagggtaccacatcccaaagggcgccatgatagttccactgcaatgg
gctgtgcatatggatcctaactattggtcaaagccagagtgcttcaatccagaaagattt
ctaacacacgacggacgattcaacaaaccagaatttttcatcccctttcagacaggaaag
agaatgtgtgttggcgaagaattagctcgaatgttgctgtttttgtttggagcgaccatc
attcacaaattcaacatcaaggcaccagagggcgttgacgtcgatctagaaggtatctgt
ggtataacgcttaccccaaaacatcaaagactgcttttcagtcctcgattttga

DBGET integrated database retrieval system