Zingiber officinale (ginger): 121967776 Help Entry 121967776         CDS       T08725                                  Name (RefSeq) calmodulin-3-like   KO K02183   calmodulin Organism zof  Zingiber officinale (ginger) Pathway zof04016   MAPK signaling pathway - plant zof04070   Phosphatidylinositol signaling system zof04075   Plant hormone signal transduction zof04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:zof00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     121967776    04070 Phosphatidylinositol signaling system     121967776    04075 Plant hormone signal transduction     121967776  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     121967776  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:zof01009]     121967776   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:zof04131]     121967776    03036 Chromosome and associated proteins [BR:zof03036]     121967776   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:zof04147]     121967776 Protein phosphatases and associated proteins [BR:zof01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      121967776 Membrane trafficking [BR:zof04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     121967776 Chromosome and associated proteins [BR:zof03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      121967776 Exosome [BR:zof04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    121967776 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH EF_EFCAB10_C SPARC_Ca_bdg EF-hand_11 UPF0154 DUF5580_M EFhand_Ca_insen RNA_pol_Rpb4 Dockerin_1 Caleosin MotA_activ SPEF2_C FCaBP_EF-hand SurA_N_3 DUF6279 Fe_hyd_lg_C PA_Ig-like MecA_N Motif Other DBs NCBI-GeneID:  121967776 NCBI-ProteinID:  XP_042374145 LinkDB All DBs Position 3B:131334336..131340372 Genome browser AA seq 149 aa AA seqDB search MAEQLTDDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLNLMARKMKDTDSEEELREAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE EVDEMIREADVDGDGQINYDEFVKVMMAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcggaacaattgacggatgaccagatcgccgagttcaaggaggccttcagcctcttc gataaggacggggacggttgcattacgactaaagagcttggaactgtgatgcgatcgttg ggccagaatcctacagaagcagagctgcaggacatgatcaatgaggtcgacgctgatggc aacggaactatagactttccagagtttcttaatctgatggctcgtaaaatgaaggataca gactcagaagaggagcttagggaggccttcagagtgttcgacaaggatcagaatggtttc atttctgctgctgagcttcgtcatgtcatgaccaatcttggagagaagttgactgacgag gaggtcgatgaaatgatccgtgaagccgatgtggatggtgatggtcaaatcaactatgat gagtttgttaaagtcatgatggccaagtga

DBGET integrated database retrieval system