Zingiber officinale (ginger): 121976969 Help Entry 121976969         CDS       T08725                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism zof  Zingiber officinale (ginger) Brite KEGG Orthology (KO) [BR:zof00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:zof03041]     121976969   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:zof04052]     121976969 Spliceosome [BR:zof03041]  Complex B   Other components    Complex B specific factors     121976969 Cytokines and neuropeptides [BR:zof04052]  Neuropeptides   Unclassified    121976969 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Rad60-SLD Ubiquitin_4 OTU1_UBXL Crinkler Motif Other DBs NCBI-GeneID:  121976969 NCBI-ProteinID:  XP_042385353 LinkDB All DBs Position 4B:137319110..137323108 Genome browser AA seq 73 aa AA seqDB search MIEVVLNDRLGKKVRVKCNEDDTIGDLKKLVAAQTGTRADKIRIQKWYNIYKDHITLKDY EIHDGMGLELYYN NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcgaggtagttctcaacgatcggctggggaagaaggtcagggtgaagtgcaacgag gatgataccatcggcgacctcaagaagctggtggcggcgcagaccggcacccgtgccgat aagatccgtatccagaaatggtacaacatctacaaggatcacatcactctcaaggactac gagatccacgacggcatgggcctcgagctctactacaactaa

DBGET integrated database retrieval system