Zingiber officinale (ginger): 121978755 Help Entry 121978755         CDS       T08725                                  Name (RefSeq) rac-like GTP-binding protein 2   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism zof  Zingiber officinale (ginger) Pathway zof04145   Phagosome zof04148   Efferocytosis zof04620   Toll-like receptor signaling pathway zof05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:zof00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     121978755    04148 Efferocytosis     121978755  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     121978755  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     121978755  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:zof04131]     121978755   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:zof04147]     121978755    04031 GTP-binding proteins [BR:zof04031]     121978755 Membrane trafficking [BR:zof04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     121978755  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     121978755   Macropinocytosis    Ras GTPases     121978755  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     121978755 Exosome [BR:zof04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    121978755   Exosomal proteins of other body fluids (saliva and urine)    121978755   Exosomal proteins of colorectal cancer cells    121978755   Exosomal proteins of bladder cancer cells    121978755 GTP-binding proteins [BR:zof04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     121978755 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Motif Other DBs NCBI-GeneID:  121978755 NCBI-ProteinID:  XP_042386988 LinkDB All DBs Position 4B:138910838..138911682 Genome browser AA seq 122 aa AA seqDB search MLTFLVYEHQWMPELRRYAPNVPIVLVGTKLDLRDDKAYLADHPGATTITPAQREGLRKQ TGAAAYIECTSKTQQNVKAVFDTAIKVVLQPPRTKETAKKKTKRSSGCLMANLICGGGTC VS NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atgttgacatttttggtttatgaacaccagtggatgccagaactacgccggtatgcgcct aatgttcctatagttttggttggaacaaaattagatctccgtgatgacaaagcttatctt gctgatcatcctggtgcaacaacaataactccagcacaaagggaaggactgaggaaacaa actggtgctgcagcatatattgaatgtacctccaaaacccaacagaatgtcaaagctgta tttgatactgcaatcaaggtggttcttcaacccccacgaacgaaggagacagccaagaaa aaaaccaaaagaagctctggttgtctaatggcaaatctcatatgtggaggcggcacatgc gtgagctag

DBGET integrated database retrieval system