Zingiber officinale (ginger): 121983218 Help Entry 121983218         CDS       T08725                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism zof  Zingiber officinale (ginger) Pathway zof03083   Polycomb repressive complex zof04120   Ubiquitin mediated proteolysis zof04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:zof00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     121983218    04120 Ubiquitin mediated proteolysis     121983218   09126 Chromosome    03083 Polycomb repressive complex     121983218  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:zof04131]     121983218    04121 Ubiquitin system [BR:zof04121]     121983218    03036 Chromosome and associated proteins [BR:zof03036]     121983218 Membrane trafficking [BR:zof04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     121983218 Ubiquitin system [BR:zof04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      121983218    Cul7 complex      121983218 Chromosome and associated proteins [BR:zof03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      121983218   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      121983218 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ BTB Motif Other DBs NCBI-GeneID:  121983218 NCBI-ProteinID:  XP_042392108 LinkDB All DBs Position 5A:126589343..126590250 Genome browser AA seq 152 aa AA seqDB search MDKKITLLSSDGEAFEVDAAVAMKSQTIKHMVEDNCAEDAIPLPNVTSKILAKVIEYCQK HVDDPAESSDDKEELKSWSAKFVDVDQPTLFDLLLAANYMDIKGLLDLLCQTIANMITGK TPEEIRKTFNIKNDFTPEEEAEVRKENQWAFQ NT seq 459 nt NT seq  +upstreamnt  +downstreamnt atggacaagaagatcactctgttgagctccgacggcgaggcgttcgaggtggacgctgcg gtggccatgaagtcgcagaccatcaagcacatggtcgaggacaactgtgcagaggacgcg atccccctccccaacgtcacctccaagatcctcgccaaggtcattgagtactgccagaag cacgtcgatgaccccgccgagtcttccgacgacaaagaagaactcaagtcttggagtgcc aaattcgttgacgtcgaccagccaaccctattcgatctcctcttggctgcaaactacatg gacatcaaggggctgttggatttgctatgtcagactatagctaatatgatcacggggaag actcctgaagagattcgcaagacattcaacatcaaaaacgacttcacccccgaggaagag gcagaggttcgcaaggagaaccagtgggcctttcagtaa

DBGET integrated database retrieval system