Zingiber officinale (ginger): 122007244 Help Entry 122007244         CDS       T08725                                  Name (RefSeq) calmodulin-1-like   KO K02183   calmodulin Organism zof  Zingiber officinale (ginger) Pathway zof04016   MAPK signaling pathway - plant zof04070   Phosphatidylinositol signaling system zof04075   Plant hormone signal transduction zof04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:zof00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     122007244    04070 Phosphatidylinositol signaling system     122007244    04075 Plant hormone signal transduction     122007244  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     122007244  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:zof01009]     122007244   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:zof04131]     122007244    03036 Chromosome and associated proteins [BR:zof03036]     122007244   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:zof04147]     122007244 Protein phosphatases and associated proteins [BR:zof01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      122007244 Membrane trafficking [BR:zof04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     122007244 Chromosome and associated proteins [BR:zof03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      122007244 Exosome [BR:zof04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    122007244 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH SPARC_Ca_bdg EF_EFCAB10_C EF-hand_11 UPF0154 Dockerin_1 EFhand_Ca_insen DUF5580_M Caleosin FCaBP_EF-hand MotA_activ SPEF2_C PA_Ig-like SurA_N_3 MecA_N DUF6279 Motif Other DBs NCBI-GeneID:  122007244 NCBI-ProteinID:  XP_042419003 LinkDB All DBs Position 7B:118940930..118943497 Genome browser AA seq 149 aa AA seqDB search MADKLTDDQIAEFKEAFSLFDKDGDGSITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE EVDEMIREADVDGDGQINYEEFVKVMMAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcggacaagctcaccgacgaccagatcgctgagttcaaggaggcgttcagcttgttc gacaaggacggcgacggtagcatcacaactaaggaactcgggactgtgatgcgttctttg ggtcagaaccctaccgaagccgaactgcaggacatgataaacgaggttgatgcagacggc aatggcacgattgatttcccagagtttcttaatctgatggctcgcaagatgaaggatact gattcagaggaagaactgaaggaagcattccgtgtgtttgacaaagaccagaatggcttc atctcagcagctgaactccgtcatgtgatgactaacctgggagagaaactcacagacgag gaggtggacgaaatgattcgcgaagctgatgttgacggtgatggccagattaactatgag gaatttgttaaggtcatgatggccaagtga

DBGET integrated database retrieval system