Zingiber officinale (ginger): 122022910 Help Entry 122022910         CDS       T08725                                  Name (RefSeq) ras-related protein Rab7-like   KO K07897   Ras-related protein Rab-7A [EC:3.6.5.2] Organism zof  Zingiber officinale (ginger) Pathway zof04142   Lysosome biogenesis zof04144   Endocytosis zof04145   Phagocytosis zof04148   Efferocytosis Brite KEGG Orthology (KO) [BR:zof00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     122022910    04145 Phagocytosis     122022910    04142 Lysosome biogenesis     122022910    04148 Efferocytosis     122022910  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:zof04131]     122022910   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:zof04147]     122022910    04031 GTP-binding proteins [BR:zof04031]     122022910 Enzymes [BR:zof01000]  3. Hydrolases   3.6  Acting on acid anhydrides    3.6.5  Acting on GTP to facilitate cellular and subcellular movement     3.6.5.2  small monomeric GTPase      122022910 Membrane trafficking [BR:zof04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     122022910  Endosome - Golgi transport     122022910 Exosome [BR:zof04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    122022910   Exosomal proteins of other body fluids (saliva and urine)    122022910   Exosomal proteins of colorectal cancer cells    122022910   Exosomal proteins of bladder cancer cells    122022910 GTP-binding proteins [BR:zof04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     122022910 SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 Gtr1_RagA GTP_EFTU Motif Other DBs NCBI-GeneID:  122022910 NCBI-ProteinID:  XP_042436951 LinkDB All DBs Position 9B:31229479..31230987 Genome browser AA seq 139 aa AA seqDB search MRALSDPPLREYHVWWSLSDSKYGGSTTLLSKKQLEPKKNYKKNPYRHCVGKTSLMNQYV HKKFTQQYKVTIGADFVTKEILVDDRLVTLQIWDTTGQERFQSLGVAFYRGVDCCVLVYD VNVRRSFDTLDNWHDEFLN NT seq 420 nt NT seq  +upstreamnt  +downstreamnt atgcgggctttatcagatcctccacttcgagaataccatgtgtggtggtctctttcggat tccaagtacggtggaagtactactttgctttccaaaaagcaacttgagcctaagaagaac tacaagaaaaatccttatagacattgtgttggaaagacgtcgctgatgaaccaatatgtg cacaaaaagttcacgcagcagtataaggtcaccattggcgctgattttgtcaccaaggaa attctagttgatgacagactcgttaccttgcagatttgggatactacaggacaagaaaga ttccagagtcttggtgttgcattctacagaggagttgactgctgcgtcttggtctatgat gttaatgtccgaagatcatttgacactcttgataattggcatgatgaatttcttaattag

DBGET integrated database retrieval system