Zingiber officinale (ginger): 122023509 Help Entry 122023509         CDS       T08725                                  Name (RefSeq) rac-like GTP-binding protein 7   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism zof  Zingiber officinale (ginger) Pathway zof04145   Phagosome zof04148   Efferocytosis zof04517   IgSF CAM signaling zof04518   Integrin signaling zof04620   Toll-like receptor signaling pathway zof05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:zof00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     122023509    04518 Integrin signaling     122023509  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     122023509    04148 Efferocytosis     122023509  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     122023509  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     122023509  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:zof04131]     122023509   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:zof04147]     122023509    04031 GTP-binding proteins [BR:zof04031]     122023509 Membrane trafficking [BR:zof04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     122023509  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     122023509   Macropinocytosis    Ras GTPases     122023509  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     122023509 Exosome [BR:zof04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    122023509   Exosomal proteins of other body fluids (saliva and urine)    122023509   Exosomal proteins of colorectal cancer cells    122023509   Exosomal proteins of bladder cancer cells    122023509 GTP-binding proteins [BR:zof04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     122023509 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Sua5_C Motif Other DBs NCBI-GeneID:  122023509 NCBI-ProteinID:  XP_042437570 LinkDB All DBs Position 9B:complement(105339386..105340640) Genome browser AA seq 196 aa AA seqDB search MSAARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVIVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENIYKKWVPELRHYAPTVPIVLVGTKL DLREDKQYFLDHPGATPITTAQGEELKKMIGAAVYIECSSKTQQNVKAVFDAAIKVVLCP PKLKKKSRKQRKCLIL NT seq 591 nt NT seq  +upstreamnt  +downstreamnt atgagcgccgcgaggttcatcaagtgtgtgaccgtcggcgacggagccgtggggaagacg tgcatgctcatctcctacaccagcaatacttttccgacggattacgtgccgacggtgttc gacaatttcagcgccaatgtgatcgtagacgggagcacggtcaacctcgggctttgggac acagcagggcaagaggactacaacaggctcagacccctgagttacagaggagccgatgtg tttctgctggcattttctctcatcagtaaagcaagctacgagaacatttacaagaagtgg gttccagagctgaggcactatgctccgactgtgccaattgttcttgtgggaacaaaactc gatttacgcgaagacaagcaatatttccttgatcatcctggagcaactccgatcactact gcacagggagaagagttgaagaagatgatcggcgcagctgtctacatcgagtgcagttct aaaactcagcagaatgtgaaggccgtcttcgatgctgcgataaaagtagttctttgcccg cctaagctgaagaagaagagccgaaagcagagaaaatgcttgatcttgtga

DBGET integrated database retrieval system