Zingiber officinale (ginger): 122025452 Help Entry 122025452         CDS       T08725                                  Name (RefSeq) ras-related protein Rab7-like   KO K07897   Ras-related protein Rab-7A Organism zof  Zingiber officinale (ginger) Pathway zof04144   Endocytosis zof04145   Phagosome zof04148   Efferocytosis Brite KEGG Orthology (KO) [BR:zof00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     122025452    04145 Phagosome     122025452    04148 Efferocytosis     122025452  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:zof04131]     122025452   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:zof04147]     122025452    04031 GTP-binding proteins [BR:zof04031]     122025452 Membrane trafficking [BR:zof04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     122025452 Exosome [BR:zof04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    122025452   Exosomal proteins of other body fluids (saliva and urine)    122025452   Exosomal proteins of colorectal cancer cells    122025452   Exosomal proteins of bladder cancer cells    122025452 GTP-binding proteins [BR:zof04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     122025452 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf Gtr1_RagA GTP_EFTU Motif Other DBs NCBI-GeneID:  122025452 NCBI-ProteinID:  XP_042440191 LinkDB All DBs Position 9B:30930119..30932611 Genome browser AA seq 105 aa AA seqDB search MNQYVHKKFMQQYKVTIGADFVTKEILVDDKLVTLQIWDTAGQERFQSLGVAFYRGVDCC VLVYDVNVRRSFDTLDNWHDEFLNQVHTKGSQAFPFLILCWLVRD NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgaaccaatatgtgcacaaaaagttcatgcagcagtataaggtcaccattggcgctgat tttgtcaccaaggaaattctagttgatgacaaactggttaccttgcagatttgggatact gcaggacaagaaagattccagagtcttggtgttgcattctacagaggagttgactgttgc gtcttggtctatgatgttaatgtccgaagatcatttgacactcttgataattggcatgat gaattccttaatcaggttcatactaaagggtctcaggcattcccctttctgatattatgc tggttggtgagagattga

DBGET integrated database retrieval system