Zingiber officinale (ginger): 122029249 Help Entry 122029249         CDS       T08725                                  Name (RefSeq) ras-related protein Rab7-like   KO K07897   Ras-related protein Rab-7A Organism zof  Zingiber officinale (ginger) Pathway zof04144   Endocytosis zof04145   Phagosome zof04148   Efferocytosis Brite KEGG Orthology (KO) [BR:zof00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     122029249    04145 Phagosome     122029249    04148 Efferocytosis     122029249  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:zof04131]     122029249   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:zof04147]     122029249    04031 GTP-binding proteins [BR:zof04031]     122029249 Membrane trafficking [BR:zof04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     122029249 Exosome [BR:zof04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    122029249   Exosomal proteins of other body fluids (saliva and urine)    122029249   Exosomal proteins of colorectal cancer cells    122029249   Exosomal proteins of bladder cancer cells    122029249 GTP-binding proteins [BR:zof04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     122029249 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 Gtr1_RagA GTP_EFTU YwhD Motif Other DBs NCBI-GeneID:  122029249 NCBI-ProteinID:  XP_042444122 LinkDB All DBs Position 10B:86566780..86568830 Genome browser AA seq 107 aa AA seqDB search MNLTCGSVGKTSLMNQYVHKKFTQQYKVTIGVDFVTKEILVDDRLVTLQIWDTAGQERFQ SLGVAFYRGVDCCVLVYDVNVRRSFDTLDNWHDEFLNQVHSIISLAF NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atgaaccttacgtgtggcagtgttggaaagacgtcgctgatgaaccaatatgtgcacaaa aagttcacgcagcagtataaggtcaccattggcgttgattttgtcaccaaggaaattcta gttgatgacagactcgttaccttgcagatttgggatactgcaggacaagaaagattccag agtcttggtgttgcattctacagaggagttgactgctgcgtcttggtctatgatgttaat gtccgaagatcatttgacactcttgataattggcatgatgaatttcttaatcaggtccat agtattatctctttggctttctag

DBGET integrated database retrieval system