Zingiber officinale (ginger): 122030822 Help Entry 122030822         CDS       T08725                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism zof  Zingiber officinale (ginger) Pathway zof04145   Phagosome zof04148   Efferocytosis zof04517   IgSF CAM signaling zof04518   Integrin signaling zof04620   Toll-like receptor signaling pathway zof05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:zof00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     122030822    04518 Integrin signaling     122030822  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     122030822    04148 Efferocytosis     122030822  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     122030822  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     122030822  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:zof04131]     122030822   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:zof04147]     122030822    04031 GTP-binding proteins [BR:zof04031]     122030822 Membrane trafficking [BR:zof04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     122030822  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     122030822   Macropinocytosis    Ras GTPases     122030822  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     122030822 Exosome [BR:zof04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    122030822   Exosomal proteins of other body fluids (saliva and urine)    122030822   Exosomal proteins of colorectal cancer cells    122030822   Exosomal proteins of bladder cancer cells    122030822 GTP-binding proteins [BR:zof04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     122030822 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU AAA_7 Motif Other DBs NCBI-GeneID:  122030822 NCBI-ProteinID:  XP_042445800 LinkDB All DBs Position 11A:complement(49184980..49190821) Genome browser AA seq 195 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELKHYAPGVPVILVGTKL DLRDDQQFFIDHPGSQPISTAQGEELKRTIDSPAYIECSAKTQVNIKAVFDMAIKVVLQP PKQKKKKGKALCTIL NT seq 588 nt NT seq  +upstreamnt  +downstreamnt atgagtgcatcgaggttcataaagtgtgttacggtgggcgacggtgccgtcgggaagacc tgcatgctcatatcgtataccagtaacacgttccccacggattatgtaccaaccgtattt gataactttagtgcgaacgttgtagtcgatggcaacacggttaacttagggctgtgggac accgcaggccaggaagattacaatagactcagacctttaagctaccgaggtgctgatgtc ttccttctagccttctctttgataagtaaggctagctatgaaaacgtagctaaaaagtgg atacctgaattgaaacattatgcgcccggtgtgccagttattctcgttggcacaaaactt gatctccgtgacgaccaacagtttttcatagatcaccctggctctcagccaataagtact gcacagggggaagagttaaagagaacaatcgactctcctgcttatattgaatgcagtgca aaaacccaagtgaacataaaggcagtttttgacatggctattaaagtggtgcttcaaccg ccaaaacaaaagaaaaagaaagggaaggcactttgcaccatactgtga

DBGET integrated database retrieval system