Zingiber officinale (ginger): 122036109 Help Entry 122036109         CDS       T08725                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism zof  Zingiber officinale (ginger) Pathway zof04145   Phagosome zof04148   Efferocytosis zof04620   Toll-like receptor signaling pathway zof05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:zof00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     122036109    04148 Efferocytosis     122036109  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     122036109  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     122036109  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:zof04131]     122036109   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:zof04147]     122036109    04031 GTP-binding proteins [BR:zof04031]     122036109 Membrane trafficking [BR:zof04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     122036109  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     122036109   Macropinocytosis    Ras GTPases     122036109  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     122036109 Exosome [BR:zof04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    122036109   Exosomal proteins of other body fluids (saliva and urine)    122036109   Exosomal proteins of colorectal cancer cells    122036109   Exosomal proteins of bladder cancer cells    122036109 GTP-binding proteins [BR:zof04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     122036109 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU AAA_7 Motif Other DBs NCBI-GeneID:  122036109 NCBI-ProteinID:  XP_042451254 LinkDB All DBs Position Unknown AA seq 197 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL DLRDDKQFFIDHPGAVPISSAQGEELQKQIAAAAYLECSSKTQQNVKAVFDAAIKIVLQP PKQKKKKKKQHKNCSIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagtgcttcgaggtttattaagtgcgtcactgtgggagacggcgccgtgggcaagacc tgcatgcttatctcctacaccagcaacactttcccaactgattatgttcctacagttttt gacaatttcagtgccaatgtcgtggtggatggtagcacggttaacttaggtctgtgggat actgcaggccaagaggattacaatcgattgagacctttgagctatcgtggtgctgatgtt ttcttgcttgccttctctctcattagcaaagccagctatgaaaatgttgcaaagaagtgg atacctgagctgaggcactatgcacctggtgtgccgataattcttgttggaacaaagctg gatcttcgggatgataaacaatttttcattgatcacccaggagctgttcctataagtagt gctcagggcgaggaactgcagaagcaaatagccgcggccgcttacttggaatgcagttca aagactcagcaaaacgtcaaggcagtcttcgatgcggctatcaagattgttcttcaacca cccaagcaaaagaagaagaagaagaagcaacataaaaattgttctatattgtaa

DBGET integrated database retrieval system