Zingiber officinale (ginger): 122038709 Help Entry 122038709         CDS       T08725                                  Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism zof  Zingiber officinale (ginger) Pathway zof04136   Autophagy - other Brite KEGG Orthology (KO) [BR:zof00001]  09140 Cellular Processes   09141 Transport and catabolism    04136 Autophagy - other     122038709  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:zof04131]     122038709    04121 Ubiquitin system [BR:zof04121]     122038709    03029 Mitochondrial biogenesis [BR:zof03029]     122038709 Membrane trafficking [BR:zof04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     122038709 Ubiquitin system [BR:zof04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    122038709 Mitochondrial biogenesis [BR:zof03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     122038709 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 ATG8 Motif Other DBs NCBI-GeneID:  122038709 NCBI-ProteinID:  XP_042454532 LinkDB All DBs Position 1A:complement(186576270..186581092) Genome browser AA seq 94 aa AA seqDB search MAVDSPTADRKVVVHLRATGDAPILKQAKFKISGSDKFSKVIEFLRRQLHRDTLFVYINS SFSPNPDELVIDLYNNFGFDGKLVVNYASSMAWG NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atggcggttgattcgcccacggctgaccgaaaagtggttgttcatctgagggcgactggc gacgctcctatccttaaacaagccaaattcaagatttccggaagcgacaaattctcaaag gtcattgaatttctccgccgacaacttcaccgcgatactttgtttgtatatatcaacagt tccttttcaccaaacccagatgaattggtgattgatctctataataactttggatttgac ggtaagctagttgttaactatgcttcttccatggcatggggctga

DBGET integrated database retrieval system